Importin alpha 5/KPNA1/SRP1 Antibody


Western Blot: Importin alpha 5/KPNA1/SRP1 Antibody [NBP1-54604] - Jurkat, Antibody Dilution: 1.0 ug/ml.
Western Blot: Importin alpha 5/KPNA1/SRP1 Antibody [NBP1-54604] - Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.
Western Blot: Importin alpha 5/KPNA1/SRP1 Antibody [NBP1-54604] - Human Fetal Brain, Antibody Dilution: 1.0 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC

Order Details

Importin alpha 5/KPNA1/SRP1 Antibody Summary

Synthetic peptides corresponding to KPNA1(karyopherin alpha 1 (importin alpha 5)) The peptide sequence was selected from the N terminal of KPNA1. Peptide sequence NMEMAPGGVITSDMIEMIFSKSPEQQLSATQKFRKLLSKEPNPPIDEVIS.
This product is specific to Subunit or Isoform: alpha-1.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
  • Immunohistochemistry
Application Notes
This is a rabbit polyclonal antibody against KPNA1 and was validated on Western blot.
Theoretical MW
60 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Importin alpha 5/KPNA1/SRP1 Antibody

  • Importin alpha 5
  • importin subunit alpha-1
  • importin-alpha-S1
  • IPOA5
  • karyopherin alpha 1 (importin alpha 5)
  • Karyopherin subunit alpha-1
  • KPNA1
  • NPI-1
  • NPI-1SRP1importin alpha 5
  • Nucleoprotein interactor 1
  • RCH2
  • RCH2RAG cohort protein 2
  • recombination activating gene cohort 2
  • SRP1
  • SRP1-beta


Recombination activating proteins RAG1 and RAG2 regulate and mediate V(D)J recombination, the process by which genes for immunoglobulins and T-cell receptors are generated. Several other ubiquitously expressed proteins are thought to be recruited in the recombination process. Among these are the genes affected in severe combined immune deficiency and genes involved in ds-DNA break repair. KPNA1 interacts with RAG1 and may play a role in V(D)J recombination.Recombination activating proteins RAG1 and RAG2 regulate and mediate V(D)J recombination, the process by which genes for immunoglobulins and T-cell receptors are generated. Several other ubiquitously expressed proteins are thought to be recruited in the recombination process. Among these are the genes affected in severe combined immune deficiency and genes involved in ds-DNA break repair. The protein encoded by this gene interacts with RAG1 and may play a role in V(D)J recombination. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICFlow
Species: Hu
Applications: WB, IHC, ICC
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu
Species: Mu
Applications: WB, ChIP
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IP
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC

Publications for Importin alpha 5/KPNA1/SRP1 Antibody (NBP1-54604) (0)

There are no publications for Importin alpha 5/KPNA1/SRP1 Antibody (NBP1-54604).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Importin alpha 5/KPNA1/SRP1 Antibody (NBP1-54604) (0)

There are no reviews for Importin alpha 5/KPNA1/SRP1 Antibody (NBP1-54604). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Importin alpha 5/KPNA1/SRP1 Antibody (NBP1-54604) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for Importin alpha 5/KPNA1/SRP1 Antibody (NBP1-54604)

Discover related pathways, diseases and genes to Importin alpha 5/KPNA1/SRP1 Antibody (NBP1-54604). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Importin alpha 5/KPNA1/SRP1 Antibody (NBP1-54604)

Discover more about diseases related to Importin alpha 5/KPNA1/SRP1 Antibody (NBP1-54604).

Pathways for Importin alpha 5/KPNA1/SRP1 Antibody (NBP1-54604)

View related products by pathway.

PTMs for Importin alpha 5/KPNA1/SRP1 Antibody (NBP1-54604)

Learn more about PTMs related to Importin alpha 5/KPNA1/SRP1 Antibody (NBP1-54604).

Blogs on Importin alpha 5/KPNA1/SRP1

There are no specific blogs for Importin alpha 5/KPNA1/SRP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Importin alpha 5/KPNA1/SRP1 Antibody and receive a gift card or discount.


Gene Symbol KPNA1