ILT7/CD85g/LILRA4 Antibody - BSA Free

Immunohistochemistry-Paraffin: ILT7/CD85g/LILRA4 Antibody [NBP2-48932] - Staining of human testis shows weak to moderate membranous positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: ILT7/CD85g/LILRA4 Antibody [NBP2-48932] - Staining of human lymph node shows moderate to strong positivity in lymphoid cells.

Immunohistochemistry-Paraffin: ILT7/CD85g/LILRA4 Antibody [NBP2-48932] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Immunohistochemistry-Paraffin: ILT7/CD85g/LILRA4 Antibody [NBP2-48932] - Staining of human small intestine shows moderate membranous positivity in glandular cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ILT7/CD85g/LILRA4 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: DHRLSWTLNSHQHNHGKFQALFPMGPLTFSNRGTFRCYGYENNTPYVWSEPSD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LILRA4
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  ILT7/CD85g/LILRA4 Recombinant Protein Antigen (NBP2-48932PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ILT7/CD85g/LILRA4 Antibody - BSA Free

• CD85 antigen-like family member G
• CD85g antigen
• CD85g
• ILT7
• ILT-7
• ILT7MGC129598
• Immunoglobulin-like transcript 7
• leukocyte immunoglobulin-like receptor subfamily A member 4
• leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 4
• leukocyte immunoglobulin-like receptor, subfamily A (without TM domain), member4
• LILRA4
• MGC129597

Background

ILT7 (immunoglobulin-like transcript 7) is a member of leukocyte immunoglobulin-like receptor (LIR or LILR) gene family, also known as CD85g and LILRA4. It contains four extracellular Ig domains. In association with Fc epsilonR1 gamma, ILT7 forms a receptor complex that transduces ITAM-mediated signals. ILT7 is specifically expressed on plasmacytoid dendritic cells (pDCs), but not on myeloid dendritic cells and other peripheral blood leukocytes. ILT7 negatively regulates the innate immune functions of human pDCs. Cross-linking 17G10.2 antibody is able to trigger ILT7 mediated signaling.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LILRA4