ILT4/CD85d/LILRB2 Antibody

Western Blot: ILT4/CD85d/LILRB2 Antibody [H00010288-D01P] - Analysis of LILRB2 expression in transfected 293T cell line by LILRB2 polyclonal antibody.Lane 1: LILRB2 transfected lysate(21.20 KDa).Lane 2: Non-transfected lysate.

Product Discontinued

ILT4/CD85d/LILRB2 Antibody Summary

• Immunogen: LILRB2 (AAH41708.1, 1 a.a. - 193 a.a.) full-length human protein. MTPALTALLCLGLSLGPRTRVQAGPFPKPTLWAEPGSVISWGSPVTIWCQGSLEAQEYQLDKEGSPEPLDRNNPLEPKNKARFSIPSMTQHHAGRYRCHYYSSAGWSEPSDPLELVMTGFYNKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSGGFQALFPVGPVTPSHRRV
• Specificity: LILRB2 - leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 2,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LILRB2
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500
• Application Notes: Antibody reactive against recombinant protein with GST tag on ELISA and western blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ILT4/CD85d/LILRB2 Antibody

• CD85 antigen-like family member D
• CD85d antigen
• CD85d
• Ig-like transcript 4
• ILT4
• ILT-4
• ILT4CD85d
• Immunoglobulin-like transcript 4
• Leukocyte immunoglobulin-like receptor 2
• leukocyte immunoglobulin-like receptor subfamily B member 2 soluble isoform
• leukocyte immunoglobulin-like receptor subfamily B member 2
• leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains)
• LILRB2
• LIR2
• LIR2CD85D
• LIR-2subfamily A (with TM domain), member 6
• member 2
• MIR10
• MIR10LILRA6
• Monocyte/macrophage immunoglobulin-like receptor 10

Background

This gene is a member of the leukocyte immunoglobulin-like receptor (LIR) family, which is found in a gene cluster at chromosomal region 19q13.4. The encoded protein belongs to the subfamily B class of LIR receptors which contain two or four extracellular immunoglobulin domains, a transmembrane domain, and two to four cytoplasmic immunoreceptor tyrosine-based inhibitory motifs (ITIMs). The receptor is expressed on immune cells where it binds to MHC class I molecules on antigen-presenting cells and transduces a negative signal that inhibits stimulation of an immune response. It is thought to control inflammatory responses and cytotoxicity to help focus the immune response and limit autoreactivity. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LILRB2
• Entrez:
  • 10288(Human)