ILT4/CD85d/LILRB2 Antibody Summary
| Immunogen |
LILRB2 (AAH41708.1, 1 a.a. - 193 a.a.) full-length human protein. MTPALTALLCLGLSLGPRTRVQAGPFPKPTLWAEPGSVISWGSPVTIWCQGSLEAQEYQLDKEGSPEPLDRNNPLEPKNKARFSIPSMTQHHAGRYRCHYYSSAGWSEPSDPLELVMTGFYNKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSGGFQALFPVGPVTPSHRRV |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Mouse |
| Gene |
LILRB2 |
| Purity |
Protein G purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This antibody is useful for Western Blot |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.4) |
| Preservative |
No Preservative |
| Purity |
Protein G purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for ILT4/CD85d/LILRB2 Antibody
Background
LILRB2, also known as Leukocyte immunoglobulin-like receptor subfamily B member 2, has 2 isoforms, a 598 amino acid isoform that is 65 kDa and a 597 amino acid isoform that is approx. 65 kDa; expressed on monocytes and B-cells, and at lower levels on dendritic cells and in natural killer (NK) cells; as a receptor binds to MHC class I molecules on antigen-presenting cells and transduces a negative signal that inhibits stimulation of an immune response; also competes with CD8A for binding to class I MHC antigens and inhibits FCGR1A-mediated phosphorylation of cellular proteins and mobilization of intracellular calcium ions. Disease research is currently being performed with relation to LILRB2 and herpes simplex, chronic lymphocytic leukemia, lymphocytic leukemia, and leukemia. Interactions with this protein have been shown to involve PTPN6, FCGR1A, HLA-F, HLA-G, CD1D and other proteins in osteoclast differentiation, immune-regulatory interactions between a lymphoid and a non-lymphoid cell, adaptive immune system, and immune system pathways.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: CyTOF-reported, Neut, WB
Species: Hu
Applications: CyTOF-ready, Flow, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Mu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
Species: Hu
Applications: CyTOF-ready, Flow
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, Flow, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, IHC, Neut
Species: Mu
Applications: IP, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Species: Hu
Applications: Block, CyTOF-reported, Flow
Species: Hu
Applications: WB
Publications for ILT4/CD85d/LILRB2 Antibody (H00010288-B01P) (0)
There are no publications for ILT4/CD85d/LILRB2 Antibody (H00010288-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ILT4/CD85d/LILRB2 Antibody (H00010288-B01P) (0)
There are no reviews for ILT4/CD85d/LILRB2 Antibody (H00010288-B01P).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for ILT4/CD85d/LILRB2 Antibody (H00010288-B01P) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional ILT4/CD85d/LILRB2 Products
Blogs on ILT4/CD85d/LILRB2