ILT11/LILRA5 Antibody - BSA Free

Western Blot: ILT11/LILRA5 Antibody [NBP3-09519] - Western blot analysis of ILT11/LILRA5 in Fetal Lung as a positive control. Antibody dilution at 1.0 ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

ILT11/LILRA5 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human ILT11/LILRA5 (NP_870994). Peptide sequence GNSVTIRCQGTLEAQEYRLVKEGSPEPWDTQNPLEPKNKARFSIPSMTEH
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LILRA5
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 29 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for ILT11/LILRA5 Antibody - BSA Free

• CD85 antigen-like family member F
• CD85
• CD85f antigen
• CD85f
• ILT11
• ILT-11
• ILT11CD85f
• Immunoglobulin-like transcript 11
• leukocyte Ig-like receptor 9
• Leukocyte immunoglobulin-like receptor 9
• leukocyte immunoglobulin-like receptor subfamily A member 5 soluble
• leukocyte immunoglobulin-like receptor subfamily A member 5
• leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 5
• leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains)
• LILRA5
• LILRB7
• LIR9
• LIR-9
• LIR9immunoglobulin-like transcript 11 protein
• member 7

Background

The protein encoded by the LILRA5 gene is a member of the leukocyte immunoglobulin-like receptor (LIR) family. LIR family members are known to have activating and inibitory functions in leukocytes. Crosslink of this receptor protein on the surface of monocytes has been shown to induce calcium flux and secretion of several proinflammatory cytokines, which suggests the roles of this protein in triggering innate immune responses. This gene is one of the leukocyte receptor genes that form a gene cluster on the chromosomal region 19q13.4. Four alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LILRA5