IL-7R alpha/CD127 Recombinant Protein Antigen

Images

 
There are currently no images for IL-7R alpha/CD127 Recombinant Protein Antigen (NBP3-21313PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

IL-7R alpha/CD127 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IL-7R alpha/CD127

Source: E.coli

Amino Acid Sequence: HKKTLEHLCKKPRKNLNVSFNPESFLDCQIHRVDDIQARDEVEGFLQDTFPQQLEESEKQRLGGDVQSPNCPSEDVVITPES

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
IL7R
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-21313. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for IL-7R alpha/CD127 Recombinant Protein Antigen

  • CD127 antigen
  • CD127
  • CD127ILRA
  • CDW127
  • IL-7 R alpha
  • IL-7 receptor subunit alpha
  • IL7R alpha
  • IL-7R alpha
  • IL-7R subunit alpha
  • IL7R
  • IL7RA
  • IL-7Ra
  • IL-7R-alpha
  • interleukin 7 receptor alpha chain
  • interleukin 7 receptor isoform H5-6
  • interleukin 7 receptor
  • interleukin-7 receptor subunit alpha

Background

Interleukin-7 is a glycoprotein involved in the regulation of lymphopoiesis. Response of cells to IL7 is dependent on the presence of the interleukin 7 receptor (IL7R); the active receptor is an alpha/gamma chain heterodimer. The gamma(c) chain, which also associates with the interleukin-2 receptor, serves primarily to activate signal transduction by the IL7R complex, while the alpha chain of IL7R determines specific signaling events through its association with cytoplasmic signaling molecules. The human and mouse sequence is nearly identical. In humans, severe combined immunodeficiency is caused by genetic defects in IL-7 receptor. The tyrosine residue at the 449 position is a critical signaling site of the intracellular domain of IL-7 receptor. This site is rapidly phosphorylated by janus kinases after the IL-7 receptor is engaged.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DR2A00
Species: Hu
Applications: ELISA
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
207-IL
Species: Hu
Applications: BA
NBP2-16996
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NB100-39002
Species: Bv, Hu, Mu, Rt
Applications: Dual ISH-IHC, Flow, IB, ICC/IF, IHC,  IHC-P, IP, Single-Cell Western, WB
7268-CT
Species: Hu
Applications: BA
202-IL
Species: Hu
Applications: BA
NBP1-49045
Species: Mu
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, InhibTFunc
DY417
Species: Mu
Applications: ELISA
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
247-ILB
Species: Hu
Applications: BA
485-MI
Species: Mu
Applications: BA
AF1086
Species: Hu
Applications: Block, CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, IHC, WB
BBA24
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow
MAB4841
Species: Mu
Applications: CompCytotox, CyTOF-ready, Flow, ICC, IHC, IP, Tstim
6507-IL/CF
Species: Hu
Applications: BA
AF284
Species: Hu
Applications: CyTOF-ready, Flow, Neut, WB
NBP3-21313PEP
Species: Hu
Applications: AC

Publications for IL-7R alpha/CD127 Recombinant Protein Antigen (NBP3-21313PEP) (0)

There are no publications for IL-7R alpha/CD127 Recombinant Protein Antigen (NBP3-21313PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IL-7R alpha/CD127 Recombinant Protein Antigen (NBP3-21313PEP) (0)

There are no reviews for IL-7R alpha/CD127 Recombinant Protein Antigen (NBP3-21313PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for IL-7R alpha/CD127 Recombinant Protein Antigen (NBP3-21313PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional IL-7R alpha/CD127 Products

Research Areas for IL-7R alpha/CD127 Recombinant Protein Antigen (NBP3-21313PEP)

Find related products by research area.

Blogs on IL-7R alpha/CD127

There are no specific blogs for IL-7R alpha/CD127, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our IL-7R alpha/CD127 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol IL7R