IL-7R alpha/CD127 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

IL-7R alpha/CD127 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IL-7R alpha/CD127
  
  

  Source: E.coli

  Amino Acid Sequence: HKKTLEHLCKKPRKNLNVSFNPESFLDCQIHRVDDIQARDEVEGFLQDTFPQQLEESEKQRLGGDVQSPNCPSEDVVITPES

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: IL7R
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10-100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-21313. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
• Theoretical MW: 27 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for IL-7R alpha/CD127 Recombinant Protein Antigen

• CD127 antigen
• CD127
• CD127ILRA
• CDW127
• IL-7 R alpha
• IL-7 receptor subunit alpha
• IL7R alpha
• IL-7R alpha
• IL-7R subunit alpha
• IL7R
• IL7RA
• IL-7Ra
• IL-7R-alpha
• interleukin 7 receptor alpha chain
• interleukin 7 receptor isoform H5-6
• interleukin 7 receptor
• interleukin-7 receptor subunit alpha

Background

Interleukin-7 is a glycoprotein involved in the regulation of lymphopoiesis. Response of cells to IL7 is dependent on the presence of the interleukin 7 receptor (IL7R); the active receptor is an alpha/gamma chain heterodimer. The gamma(c) chain, which also associates with the interleukin-2 receptor, serves primarily to activate signal transduction by the IL7R complex, while the alpha chain of IL7R determines specific signaling events through its association with cytoplasmic signaling molecules. The human and mouse sequence is nearly identical. In humans, severe combined immunodeficiency is caused by genetic defects in IL-7 receptor. The tyrosine residue at the 449 position is a critical signaling site of the intracellular domain of IL-7 receptor. This site is rapidly phosphorylated by janus kinases after the IL-7 receptor is engaged.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: IL7R