IL-38/IL-1F10 Antibody

Images

 
Immunohistochemistry-Paraffin: IL-38/IL-1F10 Antibody [NBP2-31798] - IL1F10 Antibody [NBP2-31798] - Staining of human smooth muscle shows moderate cytoplasmic positivity in smooth muscle cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

IL-38/IL-1F10 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: YYIIKYADQKALYTRDGQLLVGDPVADNCCAEKICTLPNRGLDRTKVPIFLGIQGGSRCLACVETEE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IL1F10
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
IL-38/IL-1F10 Protein (NBP2-31798PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for IL-38/IL-1F10 Antibody

  • FIL1- theta
  • FKSG75
  • IL1F10
  • IL-1HY2
  • IL38
  • IL-38
  • interleukin 1 family, member 10 (theta)
  • UNQ6119/PRO20041

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF771
Species: Mu
Applications: WB, IHC, Neut
NBP2-41241
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
AF1099
Species: Hu
Applications: WB, IHC, Block, Neut
AF5739
Species: Hu, Mu, Rt
Applications: WB
MAB2669
Species: Hu
Applications: WB, Simple Western, IHC
NB100-724
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-78159
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA
NBP2-33300
Species: Hu
Applications: WB, IHC-P
NBP1-88057
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33596
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-31798
Species: Hu
Applications: IHC, IHC-P

Publications for IL-38/IL-1F10 Antibody (NBP2-31798) (0)

There are no publications for IL-38/IL-1F10 Antibody (NBP2-31798).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IL-38/IL-1F10 Antibody (NBP2-31798) (0)

There are no reviews for IL-38/IL-1F10 Antibody (NBP2-31798). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for IL-38/IL-1F10 Antibody (NBP2-31798) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IL-38/IL-1F10 Products

Bioinformatics Tool for IL-38/IL-1F10 Antibody (NBP2-31798)

Discover related pathways, diseases and genes to IL-38/IL-1F10 Antibody (NBP2-31798). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IL-38/IL-1F10 Antibody (NBP2-31798)

Discover more about diseases related to IL-38/IL-1F10 Antibody (NBP2-31798).
 

Pathways for IL-38/IL-1F10 Antibody (NBP2-31798)

View related products by pathway.

PTMs for IL-38/IL-1F10 Antibody (NBP2-31798)

Learn more about PTMs related to IL-38/IL-1F10 Antibody (NBP2-31798).

Blogs on IL-38/IL-1F10

There are no specific blogs for IL-38/IL-1F10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IL-38/IL-1F10 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IL1F10
Entrez
Uniprot