IL-33 Recombinant Protein Antigen

Images

 
There are currently no images for IL-33 Recombinant Protein Antigen (NBP3-21242PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

IL-33 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IL-33

Source: E.coli

Amino Acid Sequence: MVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
IL33
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-21242. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for IL-33 Recombinant Protein Antigen

  • C9orf26
  • C9orf26chromosome 9 open reading frame 26 (NF-HEV)
  • DKFZp586H0523
  • DVS27
  • DVS27-related protein
  • IL1F11
  • IL-1F11
  • IL33
  • IL-33
  • interleukin 33
  • Interleukin-1 family member 11
  • interleukin-33
  • NFHEV
  • NF-HEV
  • NF-HEVNFEHEV
  • Nuclear factor from high endothelial venules
  • RP11-575C20.2

Background

Interleukin 33 (IL-33) is a 32kDa proinflammatory cytokine and intracellular nuclear factor with transcriptional regulatory properties. IL-33 is structurally related to IL-1, which induces helper T cells to produce type 2 cytokines and acts through the receptor IL1RL-1 (IL1 receptor-like-1), which is known also as ST2. Binding of IL-33 to this receptor activates NF-kappa-B and MAP kinases and induces in vitro Th2 cells to produce cytokines. In vivo, IL-33 induces expression of IL-4, IL-5, IL-13 and leads to severe pathological changes in mucosal organs and in vitro, it can be divided to N-terminal fragment of 12kDa and C-terminal fragment of 18kDa by cleavage of caspase-1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DY523B-05
Species: Hu
Applications: ELISA
AF5828
Species: Hu
Applications: ICC, Neut, WB
DY413
Species: Mu
Applications: ELISA
7625
Species: Mu
Applications: ELISA
6507-IL/CF
Species: Hu
Applications: BA
201-LB
Species: Hu
Applications: BA
M5000
Species: Mu
Applications: ELISA
M6000B
Species: Mu
Applications: ELISA
NBP1-81595
Species: Hu
Applications: IHC,  IHC-P, WB
1398-TS
Species: Hu
Applications: BA
AF676
Species: Hu
Applications: CyTOF-ready, Flow, WB
DY421
Species: Mu
Applications: ELISA
NB100-56565
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
DCP00
Species: Hu
Applications: ELISA
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC,  IHC-P, KO, Simple Western, WB

Publications for IL-33 Recombinant Protein Antigen (NBP3-21242PEP) (0)

There are no publications for IL-33 Recombinant Protein Antigen (NBP3-21242PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IL-33 Recombinant Protein Antigen (NBP3-21242PEP) (0)

There are no reviews for IL-33 Recombinant Protein Antigen (NBP3-21242PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for IL-33 Recombinant Protein Antigen (NBP3-21242PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional IL-33 Products

Research Areas for IL-33 Recombinant Protein Antigen (NBP3-21242PEP)

Find related products by research area.

Blogs on IL-33.

Interleukin 33 (IL-33) - A dual function cytokine
IL-33 is a member of the interleukin family of cytokines that regulates a wide variety of cellular functions. Its receptor is ST2, an IL-1 receptor family member that also acts as a negative regulator of TLR-IL-1R signaling and the IL-1R accessory ...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our IL-33 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol IL33