IL-16 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IL-16 Source: E.coli
Amino Acid Sequence: QRARSFPLTRSQSCETKLLDEKTSKLYSISSQVSSAVMKSLLCLPSSISCAQTPCIPKEGASPTSSSNEDSAANGSAETSALDTGFSLNLSELREYTEGLTEAKEDDDG Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
IL16 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10-100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-21240. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
29 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for IL-16 Recombinant Protein Antigen
Background
Interleukin-16 (IL-16, also known as lymphocyte chemoattractant factor (LCF)) is a CD8+ T cell-derived cytokine. It acts as a chemoattractant for CD4+ T-cells, monocytes and eosinophils. IL-16 has also been shown to suppress HIV-1 replication in vitro. It is expressed as a precursor molecule (pro-IL-16) in various tissues including spleen, thymus, lymph nodes, peripheral leukocytes, bone marrow and cerebellum. The active form is assumed to be a proteolytic cleavage product of pro-IL-16 existing, under physiological conditions, predominantly as a noncovalently linked multimer. The sequence and structure of IL-16 is conserved across species, human and murine IL-16 show significant cross-species reactivity.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Mu
Applications: IHC, Neut, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, ICC
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
Species: Hu
Applications: ELISA
Species: Mu
Applications: ICC, IHC, Simple Western, WB
Species: Mu
Applications: ICC, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Mu
Applications: ELISA
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: ICC, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: CyTOF-ready, Flow, Simple Western, WB
Species: Hu
Applications: AC
Publications for IL-16 Recombinant Protein Antigen (NBP3-21240PEP) (0)
There are no publications for IL-16 Recombinant Protein Antigen (NBP3-21240PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for IL-16 Recombinant Protein Antigen (NBP3-21240PEP) (0)
There are no reviews for IL-16 Recombinant Protein Antigen (NBP3-21240PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for IL-16 Recombinant Protein Antigen (NBP3-21240PEP) (0)
Additional IL-16 Products
Research Areas for IL-16 Recombinant Protein Antigen (NBP3-21240PEP)
Find related products by research area.
|
Blogs on IL-16