IL-13R alpha 1 Antibody

Images

 
Western Blot: IL-13 R alpha 1 Antibody [NBP2-55120] - Analysis in human cell line HDLM-2.
Immunocytochemistry/ Immunofluorescence: IL-13 R alpha 1 Antibody [NBP2-55120] - Staining of human cell line A-431 shows localization to nucleoplasm & the Golgi apparatus. Antibody staining is shown in green.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

IL-13R alpha 1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ETQPPVTNLSVSVENLCTVIWTWNPPEGASSNCSLWYFSHFGDKQDKKIAPETRRSIEVPLNERICLQVGSQCSTNESEKPSILVEKCISPPEGDPESAVTELQCIWHNLSYMKCSWLPGRNT
Specificity
Specificity of human IL-13 R alpha 1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IL13RA1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Reactivity Notes

Mouse 85%, Rat 88%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for IL-13R alpha 1 Antibody

  • bB128O4.2.1 (interleukin 13 receptor, alpha 1)
  • Cancer/testis antigen 19
  • CD213a1 antigen
  • CD213a1
  • CT19
  • IL-13 R alpha 1
  • IL13 receptor alpha-1 chain
  • IL-13 receptor subunit alpha-1
  • IL13R alpha 1
  • IL-13R subunit alpha-1
  • IL13R
  • IL13RA
  • IL-13Ra
  • IL13RA1
  • IL-13Ra1
  • IL-13R-alpha-1
  • interleukin 13 receptor, alpha 1
  • interleukin-13 receptor subunit alpha-1
  • NR4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

6507-IL/CF
Species: Hu
AF146
Species: Hu
Applications: WB, Simple Western, Flow, IHC, Block, CyTOF-ready
NBP2-25241
Species: Hu, Mu
Applications: WB, ICC/IF, IP
230-4RB
Species: Hu
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-45041
Species: Hu, Po
Applications: Flow, IHC, IHC-Fr, IF
MAB4260
Species: Hu, Mu, Rt
Applications: WB, IHC, CyTOF-ready, ICC, ICFlow
NBP2-37737
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF
AF284
Species: Hu
Applications: WB, Flow, CyTOF-ready, Neut
NBP2-59451
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
7270-IL/CF
Species: Hu
AF1280
Species: Mu
Applications: WB, Simple Western, IHC
DDX0131P-100
Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-55120
Species: Hu
Applications: WB, ICC/IF

Publications for IL-13R alpha 1 Antibody (NBP2-55120) (0)

There are no publications for IL-13R alpha 1 Antibody (NBP2-55120).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IL-13R alpha 1 Antibody (NBP2-55120) (0)

There are no reviews for IL-13R alpha 1 Antibody (NBP2-55120). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for IL-13R alpha 1 Antibody (NBP2-55120) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional IL-13R alpha 1 Products

Bioinformatics Tool for IL-13R alpha 1 Antibody (NBP2-55120)

Discover related pathways, diseases and genes to IL-13R alpha 1 Antibody (NBP2-55120). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IL-13R alpha 1 Antibody (NBP2-55120)

Discover more about diseases related to IL-13R alpha 1 Antibody (NBP2-55120).
 

Pathways for IL-13R alpha 1 Antibody (NBP2-55120)

View related products by pathway.

PTMs for IL-13R alpha 1 Antibody (NBP2-55120)

Learn more about PTMs related to IL-13R alpha 1 Antibody (NBP2-55120).

Blogs on IL-13R alpha 1

There are no specific blogs for IL-13R alpha 1, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IL-13R alpha 1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IL13RA1