IL-1 RAcP/IL-1 R3 Recombinant Protein Antigen

Images

 
There are currently no images for IL-1 RAcP/IL-1 R3 Protein (NBP1-86793PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

IL-1 RAcP/IL-1 R3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IL1RAP.

Source: E. coli

Amino Acid Sequence: CRCCVTYCEGENHLRNKSRAEIHNQPQWETHLCKPVPQESETQWIQNGTRLEPPAPQISALALHHFTDLSNNNDF

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
IL1RAP
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86793.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for IL-1 RAcP/IL-1 R3 Recombinant Protein Antigen

  • C3orf13IL-1RAcPIL1R3Interleukin-1 receptor 3
  • FLJ37788
  • IL-1 R3
  • IL-1 RAcP
  • IL-1 receptor accessory protein
  • IL-1R3
  • IL-1R-3
  • IL1RAcP
  • IL-1RAcP
  • IL1RAP
  • interleukin 1 receptor accessory protein
  • interleukin-1 receptor accessory protein beta
  • interleukin-1 receptor accessory protein

Background

Nuclear factor kappa B (NF-kappaB) is a ubiquitous transcription factor and an essential mediator of gene expression during activation of immune and inflammatory responses. NF-kappaB mediates the expression of a great variety of genes in response to extracellular stimuli including IL-1, TNFalpha and LPS. A serine/threonine protein kinase associated with IL-1 receptor (IRAK) and its homologue mouse pelle-like protein kinase (mPLK) were identified recently (1,2). IRAK is associated with the IL-1 receptor subunits IL-1RI and IL-1RAcP after IL-1 binding and serves as a signaling molecule to mediate IL-1 response (3). IRAK mediates a signaling cascade leading to NF-kappaB activation by members in IL-1 family including IL-1 and a novel cytokine IL-18 (also termed IGIF) (1,4).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

201-LB
Species: Hu
Applications: BA
AF3626
Species: Mu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, IHC, ICFlow, Neut, WB
DRA00B
Species: Hu
Applications: ELISA
DY523B-05
Species: Hu
Applications: ELISA
M6000B
Species: Mu
Applications: ELISA
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC,  IHC-P, KO, Simple Western, WB
202-IL
Species: Hu
Applications: BA
AF5828
Species: Hu
Applications: ICC, Neut, WB
NBP1-77068
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IP, WB
7625
Species: Mu
Applications: ELISA
NBP2-29328
Species: Bv, Hu, Mu, Rt, Xp, Ye, Ze
Applications: BindInhib, B/N, ELISA, Flow, Func-Inh, IHC, In vitro, In vivo
DY417
Species: Mu
Applications: ELISA
MAB17761
Species: Hu, Mu, Rt
Applications: ICC, WB
200-LA
Species: Hu
Applications: BA
AF2354
Species: Mu
Applications: WB
6507-IL/CF
Species: Hu
Applications: BA
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB

Publications for IL-1 RAcP/IL-1 R3 Protein (NBP1-86793PEP) (0)

There are no publications for IL-1 RAcP/IL-1 R3 Protein (NBP1-86793PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IL-1 RAcP/IL-1 R3 Protein (NBP1-86793PEP) (0)

There are no reviews for IL-1 RAcP/IL-1 R3 Protein (NBP1-86793PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for IL-1 RAcP/IL-1 R3 Protein (NBP1-86793PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional IL-1 RAcP/IL-1 R3 Products

Research Areas for IL-1 RAcP/IL-1 R3 Protein (NBP1-86793PEP)

Find related products by research area.

Blogs on IL-1 RAcP/IL-1 R3

There are no specific blogs for IL-1 RAcP/IL-1 R3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our IL-1 RAcP/IL-1 R3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol IL1RAP