IHPK2 Antibody


Immunohistochemistry-Paraffin: IHPK2 Antibody [NBP1-89635] - Staining of human kidney shows moderate nuclear positivity in cells in glomeruli.
Immunohistochemistry-Paraffin: IHPK2 Antibody [NBP1-89635] - Staining of human stomach shows strong nuclear and cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: IHPK2 Antibody [NBP1-89635] - Staining of human placenta shows strong nuclear positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: IHPK2 Antibody [NBP1-89635] - Staining of human stomach shows strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: IHPK2 Antibody [NBP1-89635] - Staining of human skin shows moderate to strong nuclear positivity in keratinocytes.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P

Order Details

IHPK2 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: MSPAFRAMDVEPRAKGVLLEPFVHQVGGHSCVLRFNETTLCKPLVPREHQFYETLPAEMRKFTP
Specificity of human IHPK2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
IHPK2 Knockout HeLa Cell Lysate
Control Peptide

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for IHPK2 Antibody

  • EC
  • IHPK2ATP:1D-myo-inositol-hexakisphosphate phosphotransferase
  • inositol hexakisphosphate kinase 2
  • inositol hexaphosphate kinase 2
  • InsP6 kinase 2
  • P(i)-uptake stimulator
  • pi uptake stimulator
  • PIUS


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, Flow-CS
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IHC-P
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Ca, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC

Publications for IHPK2 Antibody (NBP1-89635) (0)

There are no publications for IHPK2 Antibody (NBP1-89635).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IHPK2 Antibody (NBP1-89635) (0)

There are no reviews for IHPK2 Antibody (NBP1-89635). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for IHPK2 Antibody (NBP1-89635) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional IHPK2 Products

Bioinformatics Tool for IHPK2 Antibody (NBP1-89635)

Discover related pathways, diseases and genes to IHPK2 Antibody (NBP1-89635). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IHPK2 Antibody (NBP1-89635)

Discover more about diseases related to IHPK2 Antibody (NBP1-89635).

Pathways for IHPK2 Antibody (NBP1-89635)

View related products by pathway.

PTMs for IHPK2 Antibody (NBP1-89635)

Learn more about PTMs related to IHPK2 Antibody (NBP1-89635).

Research Areas for IHPK2 Antibody (NBP1-89635)

Find related products by research area.

Blogs on IHPK2

There are no specific blogs for IHPK2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our IHPK2 Antibody and receive a gift card or discount.


Gene Symbol IP6K2