IHPK2 Antibody

Images

 
Western Blot: IHPK2 Antibody [NBP1-89635] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunocytochemistry/ Immunofluorescence: IHPK2 Antibody [NBP1-89635] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleus & intermediate filaments.
Immunohistochemistry-Paraffin: IHPK2 Antibody [NBP1-89635] - Staining of human stomach shows strong nuclear and cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

IHPK2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MSPAFRAMDVEPRAKGVLLEPFVHQVGGHSCVLRFNETTLCKPLVPREHQFYETLPAEMRKFTP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IP6K2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
IHPK2 Protein (NBP1-89635PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for IHPK2 Antibody

  • EC 2.7.4.21
  • IHPK2ATP:1D-myo-inositol-hexakisphosphate phosphotransferase
  • inositol hexakisphosphate kinase 2
  • inositol hexaphosphate kinase 2
  • InsP6 kinase 2
  • P(i)-uptake stimulator
  • pi uptake stimulator
  • PIUS

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-92026
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56618
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF347
Species: Hu
Applications: WB, IHC, Neut
NB100-56116
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-56715
Species: Hu
Applications: WB, IHC, IHC-P
NB120-2928
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00003126-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP1-86960
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56144
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NB100-56118
Species: Hu, Mu, Rt, Ca, Ge
Applications: IHC, IHC-Fr, IHC-P, IP, Flow-IC

Publications for IHPK2 Antibody (NBP1-89635) (0)

There are no publications for IHPK2 Antibody (NBP1-89635).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IHPK2 Antibody (NBP1-89635) (0)

There are no reviews for IHPK2 Antibody (NBP1-89635). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for IHPK2 Antibody (NBP1-89635) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IHPK2 Products

Bioinformatics Tool for IHPK2 Antibody (NBP1-89635)

Discover related pathways, diseases and genes to IHPK2 Antibody (NBP1-89635). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IHPK2 Antibody (NBP1-89635)

Discover more about diseases related to IHPK2 Antibody (NBP1-89635).
 

Pathways for IHPK2 Antibody (NBP1-89635)

View related products by pathway.

PTMs for IHPK2 Antibody (NBP1-89635)

Learn more about PTMs related to IHPK2 Antibody (NBP1-89635).
 

Research Areas for IHPK2 Antibody (NBP1-89635)

Find related products by research area.

Blogs on IHPK2

There are no specific blogs for IHPK2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IHPK2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IP6K2