Recombinant Human IGSF1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human IGSF1 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 242 of Human IGSF1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MTLDRPGEGATMLKTFTVLLFCIRMSLGMTSIVMDPQPELWIESNYPQAPWENITLWCRSPSRISSKFLLLKDKTQMTWIRPSHKTFQVSFLIGALTESNAGLYRCCYWKETGWSKPSKVLELEAPGQLPKPIFWIQAETPALPGCNVNILCHGWLQDLVFMLFKEGYAEPVDYQVPTGTMAIFSIDNLTPEDEGVYICRTHIQMLPTLWSEPSNPLKLVVAGGCGYGCWHLAIVVPGIMAG

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
IGSF1

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human IGSF1 Protein

  • CHTE
  • IGCD1
  • IGDC1
  • IGDC1Pituitary gland-specific factor 2
  • IGSF1
  • immunoglobulin superfamily member 1
  • immunoglobulin superfamily, member 1
  • Immunoglobulin-like domain-containing protein 1
  • InhBP
  • Inhibin-binding protein
  • KIAA0364p120
  • MGC75490
  • p120
  • PGSF2
  • PGSF2IGCD1

Background

Members of the immunoglobulin (Ig) superfamily (see MIM 147100), which includes IGSF1, have a variety of functions, but all appear to play a role in cell recognition and the regulation of cell behavior.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-85383
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-92192
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-15723
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-85383
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF5094
Species: Hu, Mu, Rt
Applications: WB
NBP2-13883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
H00008878-M01
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IP
NBP2-37574
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-48309
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-88650
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-80905
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00010963-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
H00003547-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for IGSF1 Recombinant Protein (H00003547-P01) (0)

There are no publications for IGSF1 Recombinant Protein (H00003547-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IGSF1 Recombinant Protein (H00003547-P01) (0)

There are no reviews for IGSF1 Recombinant Protein (H00003547-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IGSF1 Recombinant Protein (H00003547-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional IGSF1 Products

Bioinformatics Tool for IGSF1 Recombinant Protein (H00003547-P01)

Discover related pathways, diseases and genes to IGSF1 Recombinant Protein (H00003547-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IGSF1 Recombinant Protein (H00003547-P01)

Discover more about diseases related to IGSF1 Recombinant Protein (H00003547-P01).
 

Pathways for IGSF1 Recombinant Protein (H00003547-P01)

View related products by pathway.

PTMs for IGSF1 Recombinant Protein (H00003547-P01)

Learn more about PTMs related to IGSF1 Recombinant Protein (H00003547-P01).

Blogs on IGSF1

There are no specific blogs for IGSF1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IGSF1 Antibody
NBP1-59109

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human IGSF1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol IGSF1
Entrez