IGFBP-rP10/KAZALD1 Antibody

Images

 
Immunohistochemistry-Paraffin: IGFBP-rP10/KAZALD1 Antibody [NBP1-90453] - Staining of human spleen shows cytoplasmic positivity in spleen.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

IGFBP-rP10/KAZALD1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:IFGCEVFAYPMASIEWRKDGLDIQLPGDDPHISVQFRGGPQRFEVTGWLQIQAVRPSDEGTYRCLARNALGQVEAPASLTVLTPDQLNSTGIPQLRSLNLVPE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KAZALD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
IGFBP-rP10/KAZALD1 Protein (NBP1-90453PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for IGFBP-rP10/KAZALD1 Antibody

  • bone- and odontoblast-expressed gene 1
  • Bono1
  • FKSG28
  • FKSG40
  • FLJ24094
  • IGFBP-related protein 10
  • IGFBPrP10
  • IGFBP-rP10
  • KAZALD1
  • Kazal-type serine peptidase inhibitor domain 1
  • Kazal-type serine protease inhibitor domain 1
  • kazal-type serine protease inhibitor domain-containing protein 1
  • novel kazal-type serine protease inhibitor domain and immunoglobulin domain containing protein
  • UNQ2945/PRO21184

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91612
Species: Mu
Applications: WB
AF1519
Species: Hu
Applications: WB, IHC
NBP1-85718
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-62322
Species: Hu
Applications: WB
NBP2-38770
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF7618
Species: Hu
Applications: WB
NBP2-27194
Species: Hu, Rt, Bv, Ch, Eq, Ha, Pm
Applications: WB, ICC/IF
NBP1-33596
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-02136
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF4377
Species: Hu, Mu
Applications: WB, ICC
NB600-600
Species: Hu, Mu
Applications: WB, ChIP, ELISA, IHC, IHC-P, Flow-IC
NBP1-26612
Species: Hu
Applications: IP (-), WB
AF5596
Species: Hu
Applications: WB, IHC, ICC
NBP1-86960
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1927
Species: Hu
Applications: WB, IP, ICC
NBP1-90453
Species: Hu
Applications: IHC, IHC-P

Publications for IGFBP-rP10/KAZALD1 Antibody (NBP1-90453) (0)

There are no publications for IGFBP-rP10/KAZALD1 Antibody (NBP1-90453).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IGFBP-rP10/KAZALD1 Antibody (NBP1-90453) (0)

There are no reviews for IGFBP-rP10/KAZALD1 Antibody (NBP1-90453). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for IGFBP-rP10/KAZALD1 Antibody (NBP1-90453) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IGFBP-rP10/KAZALD1 Products

Bioinformatics Tool for IGFBP-rP10/KAZALD1 Antibody (NBP1-90453)

Discover related pathways, diseases and genes to IGFBP-rP10/KAZALD1 Antibody (NBP1-90453). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IGFBP-rP10/KAZALD1 Antibody (NBP1-90453)

Discover more about diseases related to IGFBP-rP10/KAZALD1 Antibody (NBP1-90453).
 

Pathways for IGFBP-rP10/KAZALD1 Antibody (NBP1-90453)

View related products by pathway.

PTMs for IGFBP-rP10/KAZALD1 Antibody (NBP1-90453)

Learn more about PTMs related to IGFBP-rP10/KAZALD1 Antibody (NBP1-90453).

Blogs on IGFBP-rP10/KAZALD1

There are no specific blogs for IGFBP-rP10/KAZALD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IGFBP-rP10/KAZALD1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KAZALD1
Entrez