IGFBP-1 Recombinant Protein Antigen

Images

 
There are currently no images for IGFBP-1 Protein (NBP2-33475PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

IGFBP-1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IGFBP1.

Source: E. coli

Amino Acid Sequence: QQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
IGFBP1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-33475.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for IGFBP-1 Recombinant Protein Antigen

  • alpha-pregnancy-associated endometrial globulin
  • amniotic fluid binding protein
  • binding protein-25
  • binding protein-26
  • binding protein-28
  • growth hormone independent-binding protein
  • hIGFBP-1
  • IBP1
  • IBP-1
  • IGF-binding protein 1
  • IGFBP1
  • IGFBP-1
  • IGF-BP25
  • insulin-like growth factor binding protein 1
  • insulin-like growth factor-binding protein 1
  • Placental protein 12
  • PP12AFBP

Background

IGFBP1 is a gene that codes for an IGF-binding protein that circulates in the plasma and prolongs the half-life of IGFs and works to either inhibit of stimulate the growth promoting effects while also promoting cell migration and has a length of 259 amino acids and a weight of approximately 28 kDa. Current studies are being done on several diseases and disorders relating to this gene including protein-energy malnutrition, pre-eclampsia, persistent fetal circulation syndrome, Silver-Russell syndrome, growth hormone deficiency, Ehlers-Danlos syndrome, glucose intolerance, Prader-Willi syndrome, and chronic fatigue syndrome. IGFBP1 has also been shown to have interactions with IGF1, IGF2, MMP26, TF, and ARNT in pathways such as the myometrial relaxation and contraction, HIF-1-alpha transcription factor, IGF regulation, and protein metabolism pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

291-G1
Species: Hu
Applications: BA
DGB300
Species: Hu
Applications: ELISA
292-G2
Species: Hu
Applications: BA
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC
AF674
Species: Hu
Applications: Neut, Simple Western, WB
AF1067
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
NBP1-90927
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-80549
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
AF1067
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
AF578
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, WB
AF2656
Species: Hu
Applications: IHC, WB
NBP1-89782
Species: Hu
Applications: IHC,  IHC-P, WB
AF1360
Species: Mu
Applications: IHC, WB
MAB8761
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), WB
AF1445
Species: Mu, Rt
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, Simple Western, WB
M6000B
Species: Mu
Applications: ELISA
DLP00
Species: Hu
Applications: ELISA
MAB391
Species: Hu, Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, Neut, WB

Publications for IGFBP-1 Protein (NBP2-33475PEP) (0)

There are no publications for IGFBP-1 Protein (NBP2-33475PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IGFBP-1 Protein (NBP2-33475PEP) (0)

There are no reviews for IGFBP-1 Protein (NBP2-33475PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for IGFBP-1 Protein (NBP2-33475PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional IGFBP-1 Products

Research Areas for IGFBP-1 Protein (NBP2-33475PEP)

Find related products by research area.

Blogs on IGFBP-1.

Detecting HIF alpha and beyond: Best controls for hypoxia Western blot analysis
By Rosa Moreno, PhD. Detecting HIF alpha and beyond: Best controls for hypoxia Western blot analysisPhysiological low levels of oxygen induce normal hypoxic events across biological systems. This hypoxic state activ...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our IGFBP-1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol IGFBP1