IGF2BP3 Antibody


Western Blot: IGF2BP3 Antibody [NBP1-68981] - Titration: 0.2-1 ug/ml, Positive Control: Mouse Kidney.

Product Details

Reactivity MuSpecies Glossary
Applications WB

Order Details

IGF2BP3 Antibody Summary

Synthetic peptides corresponding to Igf2bp3 (insulin-like growth factor 2 mRNA binding protein 3) The peptide sequence was selected from the middle region of Igf2bp3 (NP_076159). Peptide sequence QQNPSPQLRGRRGPGQRGSSRQASPGSVSKQKPCDLPLRLLVPTQFVGAI.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.2-1 ug/ml
Theoretical MW
63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for IGF2BP3 Antibody

  • CT98
  • hKOC
  • IGF II mRNA binding protein 3
  • IGF2 mRNA-binding protein 3
  • IGF-II mRNA-binding protein 3
  • IMP-3KH domain-containing protein overexpressed in cancer
  • IMP3VICKZ family member 3
  • insulin-like growth factor 2 mRNA binding protein 3
  • insulin-like growth factor 2 mRNA-binding protein 3
  • KH domain containing protein overexpressed in cancer
  • KOC1DKFZp686F1078
  • VICKZ3cancer/testis antigen 98


Igf2bp3 is a RNA-binding protein that act as a regulator of mRNA translation and stability. Igf2bp3 binds to the 5'-UTR of the insulin-like growth factor 2 (IGF2) mRNAs. Igf2bp3 binds to sequences in the 3'-UTR of CD44 mRNA.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IP
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, Fi, GP, Ha, Le, Ma, Pm, Rb, Sh, Sq, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, IHC, ICC
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Mu
Applications: WB

Publications for IGF2BP3 Antibody (NBP1-68981) (0)

There are no publications for IGF2BP3 Antibody (NBP1-68981).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IGF2BP3 Antibody (NBP1-68981) (0)

There are no reviews for IGF2BP3 Antibody (NBP1-68981). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IGF2BP3 Antibody (NBP1-68981) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional IGF2BP3 Products

Bioinformatics Tool for IGF2BP3 Antibody (NBP1-68981)

Discover related pathways, diseases and genes to IGF2BP3 Antibody (NBP1-68981). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IGF2BP3 Antibody (NBP1-68981)

Discover more about diseases related to IGF2BP3 Antibody (NBP1-68981).

Pathways for IGF2BP3 Antibody (NBP1-68981)

View related products by pathway.

PTMs for IGF2BP3 Antibody (NBP1-68981)

Learn more about PTMs related to IGF2BP3 Antibody (NBP1-68981).

Blogs on IGF2BP3

There are no specific blogs for IGF2BP3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our IGF2BP3 Antibody and receive a gift card or discount.


Gene Symbol IGF2BP3