IgA1 Antibody (6N7H1)

Western Blot: IgA1 Antibody (6N7H1) [NBP3-33434] - Western blot analysis of various lysates, using IgA1 Rabbit mAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 6N7H1
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

IgA1 Antibody (6N7H1) Summary

• Description: Novus Biologicals Rabbit IgA1 Antibody (6N7H1) (NBP3-33434) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 99-353 of human IgA1 (P01876).
  
  Sequence:
  VPCPVPSTPPTPSPSTPPTPSPSCCHPRLSLHRPALEDLLLGSEANLTCTLTGLRDASGVTFTWTPSSGKSAVQGPPERDLCGCYSVSSVLPGCAEPWNHGKTFTCTAAYPESKTPLTATLSKSGNTFRPEVHLLPPPSEELALNELVTLTCLARGFSPKDVLVRWLQGSQELPREKYLTWASRQEPSQGTTTFAVTSILRVAAEDWKKGDTFSCMVGHEALPLAFTQKTIDRLADWQMPPPYVVLDLPQETLEE
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: IGHA1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/mL
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for IgA1 Antibody (6N7H1)

• Arc-1
• cadherin 1, E-cadherin (epithelial)
• cadherin 1, type 1, E-cadherin (epithelial)
• cadherin-1
• calcium-dependent adhesion protein, epithelial
• CAM 120/80
• CD324 antigen
• CD324
• CDHE
• cell-CAM 120/80
• ECAD
• E-cadherin
• Epithelial cadherin
• LCAM
• UVOE-Cadherin
• uvomorulin

Background

Ig alpha is the major immunoglobulin class in body secretions. It may serve both to defend against localinfection and to prevent access of foreign antigens to the general immunologic syste

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: IGHA1