IFT122 Recombinant Protein Antigen

Images

 
There are currently no images for IFT122 Protein (NBP1-87014PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

IFT122 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IFT122.

Source: E. coli

Amino Acid Sequence: ITKQADWARNIKEPKAAVEMYISAGEHVKAIEICGDHGWVDMLIDIARKLDKAEREPLLLCATYLKKLDSPGYAAETYLKMGDLK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
IFT122
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87014.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for IFT122 Recombinant Protein Antigen

  • intraflagellar transport 122 homolog (Chlamydomonas)
  • intraflagellar transport protein 122 homolog
  • SPGWD repeat-containing protein 140
  • WD repeat domain 10
  • WD repeat-containing protein 10
  • WDR10WDR10p
  • WDR140CED

Background

IFT122 is a gene that codes for a protein necessary for cilia formation during neuronal patterning, as it recruits TULP3 to primary cilia and works as a negative regulator of Shh signaling. IFT122 has five isoforms, with lengths of 1241, 1242, 1182, 1131, and 1292 amino acids and weights of 142, 142, 135, 129, and 147 kDa respectively. Current studies are being done on several diseases and disorders including Japanese spotted fever, endemic typhus, vasomer rhinitis, trigeminal neuralgia, synostosis, brachydactyly, paraplegia, neuronitis, and hepatitis. IFT122 has also been shown to have interactions with UBC, IQCB1, and ORF.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

DY413
Species: Mu
Applications: ELISA
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
AF1759
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
212-GD
Species: Hu
Applications: Bind, BA
236-EG
Species: Hu
Applications: BA
6507-IL/CF
Species: Hu
Applications: BA
423-F8
Species: Hu, Mu
Applications: BA
H00006683-M02
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
MAB8930
Species: Hu
Applications: ICC, Simple Western, WB
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
NBP1-89946
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
M6000B
Species: Mu
Applications: ELISA
NB500-106
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, PLA, S-ELISA, Simple Western, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-82617
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF5066
Species: Hu
Applications: WB

Publications for IFT122 Protein (NBP1-87014PEP) (0)

There are no publications for IFT122 Protein (NBP1-87014PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IFT122 Protein (NBP1-87014PEP) (0)

There are no reviews for IFT122 Protein (NBP1-87014PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for IFT122 Protein (NBP1-87014PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional IFT122 Products

Blogs on IFT122

There are no specific blogs for IFT122, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our IFT122 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol IFT122