Home » IFN-gamma R2 » IFN-gamma R2 Proteins » IFN-gamma R2 Recombinant Protein Antigen

IFN-gamma R2 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for IFN-gamma R2 Protein (NBP1-90223PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

IFN-gamma R2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IFNGR2.

Source: E.coli

Amino Acid Sequence: ASPSAGFPMDFNVTLRLRAELGALHSAWVTMPWFQHYRNVTVGPPENIEVTPGEGSLIIRFSSPFDIADTSTAFFCYYVHYWEKGGIQQVKGPFRSNSISLDNLKPSRVYCLQVQAQLLWNKSNIFRVGHLSNIS
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
IFNGR2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-90223.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for IFN-gamma R2 Recombinant Protein Antigen

  • AF-1
  • AF-1interferon-gamma receptor beta chain precursor10IFNGT1Interferon gamma receptor accessory factor 1
  • IFGR2
  • IFN-gamma R2
  • IFN-gamma receptor 2
  • IFNgammaR2
  • IFN-gamma-R2
  • IFNGR2
  • IFN-gR2
  • IFNGT1
  • interferon gamma receptor 2 (interferon gamma transducer 1)
  • interferon gamma receptor 2
  • interferon gamma receptor accessory factor-1
  • interferon gamma receptor beta chain
  • Interferon gamma transducer 1

Background

IFN gamma Receptor beta encodes the non-ligand-binding beta chain of the gamma interferon receptor. Human interferon-gamma receptor is a heterodimer of IFNGR1 and IFNGR2. Defects in IFNGR2 are a cause of mendelian susceptibility to mycobacterial disease (MSMD), also known as familial disseminated atypical mycobacterial infection. MSMD is a genetically heterogeneous disease with autosomal recessive, autosomal dominant or X-linked inheritance.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

ER alpha/NR3A1
Antibody (33)
NB300-560
Western Blot: ER alpha/NR3A1 Antibody (33) [NB300-560] - Analysis of recombinant ER alpha.
Immunohistochemistry-Frozen: ER alpha/NR3A1 Antibody (33) [NB300-560] - Human breast carcinoma (B) and magnified section (C) compared with an isotype control (A).
Immunohistochemistry-Paraffin: ER alpha/NR3A1 Antibody (33) [NB300-560] - Human breast tissue (B) and magnified section (C) compared with an isotype control (A).
(1 Review)
(8 Publications)
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr, IHC-P, WB
IFN-gamma
[Unconjugated]
285-IF
Recombinant Human IFN-gamma (Catalog # 285‑IF) demonstrates anti-viral activity in HeLa human cervical epithelial carcinoma cells infected with encephalomyocarditis (EMC) virus. The activity is over 2-fold greater than the top competitor's IFN-gamma .
1 μg/lane of Recombinant Human IFN-gamma was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 17 kDa.
(2 Reviews)
(415 Publications)
Species: Hu
Applications: BA
IFN-gamma R1/CD119
Antibody (92101) [Unc ...
MAB6731
Recombinant Human IFN‑ gamma (Catalog # 285-IF) reduces the Encephalomyocarditis Virus (EMCV)-induced cytopathy in the HeLa human cervical epithelial carcinoma cell line in a dose-dependent manner (orange line). Inhibition of EMCV activity elicited by Recombinant Mouse Anti-Human IFN‑ gamma (2 ng/mL) is neutralized (green line) by increasing concentrations of Human IFN‑ gamma  R1/CD119 Monoclonal Antibody (Catalog # MAB6731). The ND50 is typically 0.01-0.03 µg/mL.
(11 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, Neut, WB
Androgen R/NR3C4
[p Ser213, p Ser210] ...
NB100-56603
Western Blot: Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) [NB100-56603] - Analysis using Azide Free version of NB100-56603. LNCaP cells (passage number 38) were serum-starved for 2 days. After serum starvation, cells were (A) left untreated, (B) treated with 100 ng/ml IGF-1 for 4h, or (C) incubated with 20 um LY294002 for 30 mi
(14 Publications)
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
NCOA2 Antibody
NB100-1756
Immunohistochemistry: NCOA2 Antibody [NB100-1756] - Sample : FFPE section of prostate adenocarcinoma. Antibody : Affinity purified rabbit anti-NCOA2/SRC2 used at a dilution of 1:100. Detection : DAB
Immunocytochemistry/Immunofluorescence: NCOA2 Antibody [NB100-1756] - The majority of estradiol-induced PR-A or PR-B cells in the VMN of female mice coexpress SRC-1 and SRC-2. Representative image taken from vehicle control wt mice Insets show the magnified image of an area within the small square box. Magnification: images, 400x; insets, 630x. Scale bar, 50um. Image collected and cropped by CiteAb from the following publication (eneuro.sfn.org/cgi/doi/10.1523/ENEURO.0012-15.2015), licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: NCOA2 Antibody [NB100-1756] - The majority of estradiol-induced PR-A or PR-B cells in the VMN of female mice coexpress SRC-1 and SRC-2. Representative images taken from estradiol-treated wt mice. Magnification: images, 400x; insets, 630x. Scale bar, 50um. Image collected and cropped by CiteAb from the following publication (eneuro.sfn.org/cgi/doi/10.1523/ENEURO.0012-15.2015), licensed under a CC-BY licence.
(1 Review)
(3 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
SRC1 Antibody
(1135)
NB200-310
Western Blot: SRC1 Antibody (1135/H4) [NB200-310] - Mouse tissue (50 ug) was separated by 5% SDS-PAGE, and the membrane was blotted with SRC1 antibody [1135] diluted at 1:2000.
(1 Review)
(4 Publications)
Species: Hu, Pm, Mu, Rt
Applications: ChIP, IP, WB
DBT Antibody
NBP1-89522
Immunocytochemistry/Immunofluorescence: DBT Antibody [NBP1-89522] - Staining of human cell line A-431 shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: DBT Antibody [NBP1-89522] - Staining of human pancreas shows weak to moderate cytoplasmic positivity in exocrine glandular cells.
Immunohistochemistry-Paraffin: DBT Antibody [NBP1-89522] - Staining of human testis shows weak to moderate cytoplasmic positivity in Leydig cells.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
CBP/KAT3A Antibody
NB100-381
Western Blot: CBP/KAT3A Antibody [NB100-381] - Detection of Human CBP by Western Blot. Samples: Whole cell lysate (5, 15 and 50 ug) from HeLa cells. Antibodies: Affinity purified rabbit anti-CBP antibody NB100-381 used for WB at 0.4 ug/ml. Detection: Chemiluminescence with an exposure time of 3 minutes.
Immunoprecipitation: CBP/KAT3A Antibody [NB100-381] - Whole cell lysate (1 mg for IP; 20% of IP loaded) from HeLa cells. Antibodies: Affinity purified rabbit anti-CBP antibody used for IP at 6 ug/mg lysate. CBP was also immunoprecipitated by rabbit anti-CBP antibody NB100-382. For blotting immunoprecipitated CBP, was used at 1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
(2 Reviews)
(1 Publication)
Species: Hu
Applications: ChIP, IP, WB
ER beta/NR3A2
Antibody (14C8)
NB200-305
Immunohistochemistry-Paraffin: ER beta/NR3A2 Antibody (14C8) [NB200-305] - Human breast carcinoma. Estrogen Receptor beta stained by Estrogen Receptor beta antibody [14C8] diluted at 1:200. Antigen Retrieval: Citrate buffer, pH 6.0, 15 min
Immunohistochemistry-Paraffin: Estrogen Receptor beta Antibody (14C8) [NB200-305] - Infiltrating lobular carcinoma of the breast.
Western Blot: ER beta/NR3A2 Antibody (14C8) [NB200-305] - Non-transfected (-) and transfected (+) 293T whole cell extracts (30 ug) were separated by 7.5% SDS-PAGE, and the membrane was blotted with Estrogen Receptor beta antibody [14C8] diluted at 1:5000. The HRP-conjugated anti-mouse IgG antibody (NBP2-19382) was used to detect the primary antibody
(75 Publications)
Species: Hu, Pm, Mu, Rb
Applications: ChIP, DB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NCOA3/AIB1 Antibody
NB100-314
Western Blot: NCOA3/AIB1 Antibody [NB100-314] - Nuclear extract (5 mcg for WB, 10 mg for CoIP) from HeLa cells. Affinity purified rabbit anti-SRC3 used at 0.33 mcg/ml for WB and 20 mcg/10 mg extract for CoIP.
Western Blot: NCOA3/AIB1 Antibody [NB100-314] - Detection of Human SRC3 by Western Blot. Samples: Whole cell lysate (50 ug) from HeLa and 293T cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-SRC3 antibody NB100-314 used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
(1 Review)
(4 Publications)
Species: Hu
Applications: IP, WB
STAT1 [p Tyr701]
Antibody
AF2894
Western blot shows lysates of Daudi human Burkitt's lymphoma cell line untreated (-) or treated (+) with Recombinant Human IFN-alpha 2a for 20 minutes. PVDF membrane was probed with 0.5 µg/mL of Rabbit Anti-Human/Mouse Phospho-STAT1 (Y701) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2894), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-STAT1 (Y701) at approximately 94 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 2.
Simple Western lane view shows lysates of Daudi human Burkitt's lymphoma cell line untreated (-) or treated (+) with Recombinant Human IFN‑ alpha A (Catalog # 11100-1) for 20 minutes, loaded at 0.2 mg/mL. A specific band was detected for Phospho-STAT1 (Y701) at approximately 86 kDa (as indicated) using 5 µg/mL of Rabbit Anti-Human/Mouse Phospho-STAT1 (Y701) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2894). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Daudi human Burkitt's lymphoma cell line was unstimulated (light orange filled histogram) or treated with 500 units/mL Recombinant Human IFN‑ alpha (Catalog # 11100-1) for 20 minutes (dark orange filled histogram), then stained with Rabbit Anti-Human/Mouse Phospho‑STAT1 (Y701) Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF2894) or control antibody (Catalog # AB-105-C, open histogram), followed by Allophycocyanin-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # F0111). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with methanol.
(1 Review)
(8 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, ICFlow, Simple Western, WB
S5a/Angiocidin
Antibody
NBP2-37888
Immunohistochemistry-Paraffin: S5a/Angiocidin Antibody [NBP2-37888] - Staining of human testis shows strong cytoplasmic and nuclear positivity in cells in seminiferous ducts.
Immunocytochemistry/Immunofluorescence: S5a/Angiocidin Antibody [NBP2-37888] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: S5a/Angiocidin Antibody [NBP2-37888] - Staining of human cerebral cortex, liver, lymph node and testis using Anti-PSMD4 antibody NBP2-37888 (A) shows similar protein distribution across tissues to independent antibody NBP1-90821 (B).
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Ferredoxin
Reductase Antibody
NBP2-38530
Western Blot: Ferredoxin Reductase Antibody [NBP2-38530] - Analysis in human cell lines A-549 and U-251MG using anti-FDXR antibody. Corresponding FDXR RNA-seq data are presented for the same cell lines. Loading control: anti-GAPDH.
Western Blot: Ferredoxin Reductase Antibody [NBP2-38530] - Analysis using Anti-FDXR antibody NBP2-38530 (A) shows similar pattern to independent antibody NBP2-38706 (B).
Immunohistochemistry-Paraffin: Ferredoxin Reductase Antibody [NBP2-38530] - Staining of human adrenal gland shows strong granular cytoplasmic positivity in glandular cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AKR1B1 Antibody
NBP1-89146
Immunohistochemistry-Paraffin: AKR1B1 Antibody [NBP1-89146] - Staining of human cerebral cortex shows low expression as expected.
Immunohistochemistry-Paraffin: AKR1B1 Antibody [NBP1-89146] - Staining in human adrenal gland and cerebral cortex tissues using anti-AKR1B1 antibody. Corresponding AKR1B1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: AKR1B1 Antibody [NBP1-89146] - Analysis in human adrenal gland and liver tissues. Corresponding AKR1B1 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Amphiregulin
[Biotin]
DY262
(41 Publications)
Species: Hu
Applications: ELISA
GR/NR3C1 Antibody
(BuGR2) - BSA Free
NB300-731
Flow Cytometry: GR/NR3C1 Antibody (BuGR2) [NB300-731] - An intracellular stain was performed on Jurkat cells with GR/NR3C1 (BuGR2) antibody NB300-731PE (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Phycoerthrin.
Flow Cytometry: GR/NR3C1 Antibody (BuGR2) [NB300-731] - Using the Alexa Fluor 647 direct conjugate An intracellular stain was performed on HeLa cells with GR/NR3C1 (BuGR2) antibody NB300-731AF647 (blue) and a matched isotype control NB600-986AF647 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
Immunocytochemistry/Immunofluorescence: GR/NR3C1 Antibody (BuGR2) [NB300-731] - Analysis of Glucocorticoid Receptor using Glucocorticoid Receptor Monoclonal Antibody (BuGR2) shows staining in A549 Cells. Glucocorticoid Receptor (green), F-Actin staining with Phalloidin (red) and nuclei with DAPI (blue) is shown. Cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with an antibody recognizing Glucocorticoid Receptor at a dilution of 1:100 over night at 4C, washed with PBS and incubated with a DyLight-488 conjugated.
(3 Reviews)
(12 Publications)
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, WB
RAR alpha/NR1B1
Antibody (763)
NB200-322
Western Blot: Retinoic Acid Receptor alpha Antibody (763) [NB200-322] - Analysis of hippocampal lysate showing specific immunolabeling of the ~48k RAR-a protein.
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, WB
IFN-gamma R2
Recombinant Protein A ...
NBP1-90223PEP
IFN-gamma R2 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for IFN-gamma R2 Protein (NBP1-90223PEP) (0)

There are no publications for IFN-gamma R2 Protein (NBP1-90223PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IFN-gamma R2 Protein (NBP1-90223PEP) (0)

There are no reviews for IFN-gamma R2 Protein (NBP1-90223PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for IFN-gamma R2 Protein (NBP1-90223PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional IFN-gamma R2 Products

Bioinformatics Tool for IFN-gamma R2 Protein (NBP1-90223PEP)

Discover related pathways, diseases and genes to IFN-gamma R2 Protein (NBP1-90223PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IFN-gamma R2 Protein (NBP1-90223PEP)

Discover more about diseases related to IFN-gamma R2 Protein (NBP1-90223PEP).
 

Pathways for IFN-gamma R2 Protein (NBP1-90223PEP)

View related products by pathway.

PTMs for IFN-gamma R2 Protein (NBP1-90223PEP)

Learn more about PTMs related to IFN-gamma R2 Protein (NBP1-90223PEP).

Blogs on IFN-gamma R2

There are no specific blogs for IFN-gamma R2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Recombinant Human IFN-gamma (Catalog # 285‑IF) demonstrates anti-viral activity in HeLa human cervical epithelial carcinoma cells infected with encephalomyocarditis (EMC) virus. The activity is over 2-fold greater than the top competitor's IFN-gamma .
IFN-gamma [Unconjugated]
285-IF-100

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our IFN-gamma R2 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol IFNGR2