IFN-alpha/beta R1 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: NISTIATVEETNQTDEDHKKYSSQTSQDSGNYSNEDESESKTSEELQQDFV |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
IFNAR1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:20 - 1:50
- Immunohistochemistry-Paraffin 1:20 - 1:50
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for IFN-alpha/beta R1 Antibody - BSA Free
Background
Interferon alpha receptor 1 (IFN-alpha R1) is a class II cytokine receptor which belongs to type I human interferons (IFNs) family. IFNs plays a role in antiviral, antiproliferative, immunomodulatory, antitumor, and antiparasitic activities by inducing transcription of IFN-stimuated genes (ISGs) through activation of the Jak-STAT pathway. Specifically, IFN- R1 is a 135-kda signal transducing subunit of the IFN alpha/beta receptor complex (IFN-alpha R) (1). IFN-alpha R1 is phospholyated through PTK- and PKC-mediated phosphorylation, which initiates docking of STAT proteins to IFNs. This leads to activation of STAT proteins by PTK-mediated phosphorylation. The mechanism behind the amplification of IFN-alpha R complex mediated transmembrane signaling has been linked to tyrosine phosphorylation on IFN-alpha R1 (2).
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Hu, Rt
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu
Applications: EnzAct
Species: Hu
Applications: ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ha, Hu, Pm, Mu, Rb, Rt
Applications: IHC, IHC-Fr, IHC-P
Species: Mu, Rt
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
Species: Hu
Applications: IHC
Publications for IFN-alpha/beta R1 Antibody (NBP2-38144) (0)
There are no publications for IFN-alpha/beta R1 Antibody (NBP2-38144).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for IFN-alpha/beta R1 Antibody (NBP2-38144) (0)
There are no reviews for IFN-alpha/beta R1 Antibody (NBP2-38144).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for IFN-alpha/beta R1 Antibody (NBP2-38144) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional IFN-alpha/beta R1 Products
Research Areas for IFN-alpha/beta R1 Antibody (NBP2-38144)
Find related products by research area.
|
Blogs on IFN-alpha/beta R1