IFIT3 Antibody

Images

 
Western Blot: IFIT3 Antibody [NBP2-32500] - Analysis in human cell line SK-MEL-30.
Immunocytochemistry/ Immunofluorescence: IFIT3 Antibody [NBP2-32500] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol & mitochondria.
Immunohistochemistry-Paraffin: IFIT3 Antibody [NBP2-32500] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: IFIT3 Antibody [NBP2-32500] - Staining of liver.
Immunohistochemistry-Paraffin: IFIT3 Antibody [NBP2-32500] - Staining of liver cancer.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

IFIT3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: HKQNGDLLQAAKCYEKELGRLLRDAPSGIGSIFLSASELEDGSEEMGQGAVSSSPRELLSNSEQL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IFIT3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:250 - 1:500
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
IFIT3 Protein (NBP2-32500PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for IFIT3 Antibody

  • CIG-49
  • GARG-49
  • IFI60Retinoic acid-induced gene G protein
  • IFIT-3
  • IFIT-4
  • IFIT4IFI-60K
  • interferon-induced protein with tetratricopeptide repeats 3
  • Interferon-induced protein with tetratricopeptide repeats 4Interferon-induced 60 kDa protein
  • IRG2
  • ISG60
  • ISG-60
  • RIG-GCIG49

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
AF771
Species: Mu
Applications: WB, IHC, Neut
NBP2-15939
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-81404
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF2065
Species: Mu
Applications: WB, Simple Western, ICC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-87431
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-71687
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-80965
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84545
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33090
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-32500
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for IFIT3 Antibody (NBP2-32500) (0)

There are no publications for IFIT3 Antibody (NBP2-32500).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IFIT3 Antibody (NBP2-32500) (0)

There are no reviews for IFIT3 Antibody (NBP2-32500). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for IFIT3 Antibody (NBP2-32500) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IFIT3 Products

Bioinformatics Tool for IFIT3 Antibody (NBP2-32500)

Discover related pathways, diseases and genes to IFIT3 Antibody (NBP2-32500). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IFIT3 Antibody (NBP2-32500)

Discover more about diseases related to IFIT3 Antibody (NBP2-32500).
 

Pathways for IFIT3 Antibody (NBP2-32500)

View related products by pathway.

PTMs for IFIT3 Antibody (NBP2-32500)

Learn more about PTMs related to IFIT3 Antibody (NBP2-32500).

Blogs on IFIT3

There are no specific blogs for IFIT3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IFIT3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IFIT3