IFIT3 Antibody

Images

 
Orthogonal Strategies: Western Blot: IFIT3 Antibody [NBP2-32500] - Analysis in human cell lines SK-MEL-30 and MCF-7 using anti-IFIT3 antibody. Corresponding IFIT3 RNA-seq data are presented for the same cell ...read more
Immunocytochemistry/ Immunofluorescence: IFIT3 Antibody [NBP2-32500] - Staining of human cell line A-431 shows localization to cytosol & mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: IFIT3 Antibody [NBP2-32500] - Staining of human skeletal muscle shows no positivity in myocytes.
Immunohistochemistry-Paraffin: IFIT3 Antibody [NBP2-32500] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: IFIT3 Antibody [NBP2-32500] - Staining of human small intestine shows moderate to strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: IFIT3 Antibody [NBP2-32500] - Staining of human rectum shows moderate to strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

IFIT3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: HKQNGDLLQAAKCYEKELGRLLRDAPSGIGSIFLSASELEDGSEEMGQGAVSSSPRELLSNSEQL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IFIT3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
IFIT3 Protein (NBP2-32500PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for IFIT3 Antibody

  • CIG-49
  • GARG-49
  • IFI60Retinoic acid-induced gene G protein
  • IFIT-3
  • IFIT-4
  • IFIT4IFI-60K
  • interferon-induced protein with tetratricopeptide repeats 3
  • Interferon-induced protein with tetratricopeptide repeats 4Interferon-induced 60 kDa protein
  • IRG2
  • ISG60
  • ISG-60
  • RIG-GCIG49

Background

IFIT3, also known as IFIT4, IFI60, and RIGG, has been identified as a key element in the IFN-alpha anti-viral pathway. Additionally, IFIT3 binding negatively regulates the apoptotic effects of ISG54. IFIT3 is also a key target of STAT1, which is important in regulating IFN responses. One study has shown that expression of RIGG in a human monocytoma line led to growth arrest at the G1/S transition.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for IFIT3 Antibody (NBP2-32500) (0)

There are no publications for IFIT3 Antibody (NBP2-32500).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IFIT3 Antibody (NBP2-32500) (0)

There are no reviews for IFIT3 Antibody (NBP2-32500). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for IFIT3 Antibody (NBP2-32500) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IFIT3 Products

Research Areas for IFIT3 Antibody (NBP2-32500)

Find related products by research area.

Blogs on IFIT3

There are no specific blogs for IFIT3, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IFIT3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IFIT3