IFIT2 Antibody - BSA Free

Immunohistochemistry-Paraffin: IFIT2 Antibody [NBP1-85617] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

IFIT2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit IFIT2 Antibody - BSA Free (NBP1-85617) is a polyclonal antibody validated for use in IHC. Anti-IFIT2 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RVCSILASLHALADQYEDAEYYFQKEFSKELTPVAKQLLHLRYGNFQLYQMKCEDKAIHHFIEGVKINQKSREKEKMKDKLQKIAKMRLSKNGADSEALHVLAFLQELNEKMQQADEDSERGLESGS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: IFIT2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: IHC reported in scientific literature (PMID: 25174799). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  IFIT2 Protein (NBP1-85617PEP)

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25174799).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for IFIT2 Antibody - BSA Free

• cig42
• G10P2IFI-54K
• GARG-39
• IFI-54
• IFI54IFIT-2
• IFI-54K
• Interferon, alpha-inducible protein (MW 54kD)
• Interferon-induced 54 kDa protein
• interferon-induced protein 54
• interferon-induced protein with tetratricopeptide repeats 2
• ISG-54 K
• ISG54
• ISG-54K
• P54

Background

Saha et al. used this antibody to study protein expression of murine GARG39/IFIT2 in relation to viral infection. Immunofluorescence localized this protein in association with the mitotic spindle in both mitotically active normal NIH3T3 and B16F10 melanoma cells. Western blotting shows approx. 55 kD band GARG39/IFIT2 in brain tissue of mice infected with Japanese encephalitis virus (JEV). Brain tissue from non-infected mice did not display this band. In 1994 Bluyssen et al. characterized the gene for murine GARG39/IFIT2 and historically the protein has been identified as interferon-induced protein with tetratricopeptide repeats 2 (IFIT-2), interferon-induced 54 kDa protein (IFI-54K), glucocorticoid-attenuated response gene 39 protein (GARG-39). Human IFIT2, with 62% amino acid sequence identity, has been referred to as Interferon-induced protein with tetratricopeptide repeats 2 (IFIT-2), Interferon-induced 54 kDa protein (IFI-54K) and ISG-54 K. Kang et al. showed with proteome analysis IFIT2 was expressed more than two-fold in human osteosarcoma cells U2OS treated with ascochlorin. Kawada et al. studied gene expression to show that IFIT2 is strongly upregulated in peripheral blood in children during the acute phase of influenza.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for IFIT2 Antibody (NBP1-85617)(1)

Publication using NBP1-85617

• Feng X, Wang Y, Ma Z et al. MicroRNA-645, up-regulated in human adencarcinoma of gastric esophageal junction, inhibits apoptosis by targeting tumor suppressor IFIT2. BMC Cancer 2014-08-29 [PMID: 25174799] (IF/IHC, Human)

Bioinformatics

• Gene Symbol: IFIT2