IDH2 Antibody

Images

 
Western Blot: IDH2 Antibody [NBP1-85784] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: IDH2 Antibody [NBP1-85784] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
Immunohistochemistry-Paraffin: IDH2 Antibody [NBP1-85784] - Staining of human heart muscle shows strong cytoplasmic positivity in myocytes.
Western Blot: IDH2 Antibody [NBP1-85784] - Analysis in human cell line MOLT-4.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

IDH2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:REPIICKNIPRLVPGWTKPITIGRHAHGDQYKATDFVADRAGTFKMVFTPKDGSGVKEWEVYNFPAGGVGMGMYNTDESISGFAHSCFQYAIQKKWPLYMSTKNTILKAYDGRFKDIFQEIFDKHYKTDFD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IDH2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Theoretical MW
51 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Positive Control
Liver Lysate (NB820-59232)
Control Peptide
IDH2 Protein (NBP1-85784PEP)
Publications
Read Publication using
NBP1-85784 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 25643707).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for IDH2 Antibody

  • D2HGA2
  • EC 1.1.1.42
  • ICD-M
  • IDH
  • IDHM
  • IDP
  • IDPM
  • isocitrate dehydrogenase [NADP], mitochondrial
  • isocitrate dehydrogenase 2 (NADP+), mitochondrial
  • mNADP-IDH
  • NADP(+)-specific ICDH
  • Oxalosuccinate decarboxylase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47804
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32259
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB110-61646
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-42210
Species: Hu
Applications: WB, Flow, IHC, IHC-P
AF2988
Species: Mu, Rt
Applications: WB
NBP2-32104
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB100-168
Species: Hu, Mu(-)
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, Flow-IC
H00171023-M05
Species: Hu
Applications: WB, ELISA
NBP1-32398
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-34980
Species: Hu
NBP1-54755
Species: Hu
Applications: WB
NBP1-87069
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-45978
Species: Hu
Applications: WB, Flow, IHC
NBP2-01506
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-02615
Species: Hu, Mk, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-65214
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-31589
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85784
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for IDH2 Antibody (NBP1-85784)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for IDH2 Antibody (NBP1-85784) (0)

There are no reviews for IDH2 Antibody (NBP1-85784). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for IDH2 Antibody (NBP1-85784) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional IDH2 Products

Bioinformatics Tool for IDH2 Antibody (NBP1-85784)

Discover related pathways, diseases and genes to IDH2 Antibody (NBP1-85784). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IDH2 Antibody (NBP1-85784)

Discover more about diseases related to IDH2 Antibody (NBP1-85784).
 

Pathways for IDH2 Antibody (NBP1-85784)

View related products by pathway.

PTMs for IDH2 Antibody (NBP1-85784)

Learn more about PTMs related to IDH2 Antibody (NBP1-85784).

Blogs on IDH2

There are no specific blogs for IDH2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IDH2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IDH2
Entrez
Uniprot