IDH2 Antibody

Western Blot: IDH2 Antibody [NBP1-85784] - Analysis in SK-BR-3 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-IDH2 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.

Immunocytochemistry/Immunofluorescence: IDH2 Antibody [NBP1-85784] - Staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: IDH2 Antibody [NBP1-85784] - Staining in human heart muscle and testis tissues using NBP1-85784 antibody. Corresponding IDH2 RNA-seq data are presented for the same tissues.

Western Blot: IDH2 Antibody [NBP1-85784] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Immunohistochemistry-Paraffin: IDH2 Antibody [NBP1-85784] - Staining of human heart muscle shows high expression.

Immunohistochemistry-Paraffin: IDH2 Antibody [NBP1-85784] - Staining of human colorectal cancer shows strong granular cytoplasmic positivity in tumor cells.

Immunohistochemistry-Paraffin: IDH2 Antibody [NBP1-85784] - Staining of human prostate shows moderate to granular cytoplasmic positivity in smooth muscle cells.

Immunohistochemistry-Paraffin: IDH2 Antibody [NBP1-85784] - Staining of human skeletal muscle shows moderate granular cytoplasmic positivity in myocytes.

Immunohistochemistry-Paraffin: IDH2 Antibody [NBP1-85784] - Staining of human testis shows weak to moderate granular cytoplasmic positivity in a small subset of cells in seminiferous ducts.

Product Discontinued

IDH2 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: REPIICKNIPRLVPGWTKPITIGRHAHGDQYKATDFVADRAGTFKMVFTPKDGSGVKEWEVYNFPAGGVGMGMYNTDESISGFAHSCFQYAIQKKWPLYMSTKNTILKAYDGRFKDIFQEIFDKHYKTDFD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: IDH2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: IHC reported in scientific literature (PMID: 25643707). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Theoretical MW: 51 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control:

  Human Liver Whole Tissue Lysate (Adult Whole Normal)

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 25643707).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for IDH2 Antibody

• D2HGA2
• EC 1.1.1.42
• ICD-M
• IDH
• IDHM
• IDP
• IDPM
• isocitrate dehydrogenase [NADP], mitochondrial
• isocitrate dehydrogenase 2 (NADP+), mitochondrial
• mNADP-IDH
• NADP(+)-specific ICDH
• Oxalosuccinate decarboxylase

Background

Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. Each NADP(+)-dependent isozyme is a homodimer. The protein encoded by this gene is the NADP(+)-dependent isocitrate dehydrogenase found in the mitochondria. It plays a role in intermediary metabolism and energy production. This protein may tightly associate or interact with the pyruvate dehydrogenase complex.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for IDH2 Antibody (NBP1-85784)(1)

Publication using NBP1-85784

• Murgia M, Nagaraj N, Deshmukh AS et al. Single muscle fiber proteomics reveals unexpected mitochondrial specialization. EMBO Rep 2015-03-01 [PMID: 25643707] (IF/IHC, Mouse)

Bioinformatics

• Gene Symbol: IDH2
• Entrez:
  • 3418(Human)
  • 269951(Mouse)
  • 361596(Rat)
• Uniprot:
  • P48735(Human)