IDH2 Antibody (5F11)

Images

 
Western Blot: IDH2 Antibody (5F11) [H00003418-M01] - Analysis of IDH2 expression in transfected 293T cell line by IDH2 monoclonal antibody (M01), clone 5F11.Lane 1: IDH2 transfected lysate(50.9 KDa).Lane 2: ...read more
Immunohistochemistry-Paraffin: IDH2 Antibody (5F11) [H00003418-M01] - Analysis of monoclonal antibody to IDH2 on formalin-fixed paraffin-embedded human colon. Antibody concentration 3 ug/ml.
ELISA: IDH2 Antibody (5F11) [H00003418-M01] - Detection limit for recombinant GST tagged IDH2 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC-P
Clone
5F11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

IDH2 Antibody (5F11) Summary

Immunogen
IDH2 (NP_002159 354 a.a. - 451 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HYREHQKGRPTSTNPIASIFAWTRGLEHRGKLDGNQDLIRFAQMLEKVCVETVESGAMTKDLAGCIHGLSNVKLNEHFLNTTDFLDTIKSNLDRALGR
Localization
Mitochondrial
Specificity
IDH2 - isocitrate dehydrogenase 2 (NADP+), mitochondrial
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
IDH2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against recombinant protein for WB. It has been used for IHC-P and ELISA.
Publications
Read Publications using H00003418-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for IDH2 Antibody (5F11)

  • D2HGA2
  • EC 1.1.1.42
  • ICD-M
  • IDH
  • IDHM
  • IDP
  • IDPM
  • isocitrate dehydrogenase [NADP], mitochondrial
  • isocitrate dehydrogenase 2 (NADP+), mitochondrial
  • mNADP-IDH
  • NADP(+)-specific ICDH
  • Oxalosuccinate decarboxylase

Background

Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. Each NADP(+)-dependent isozyme is a homodimer. The protein encoded by this gene is the NADP(+)-dependent isocitrate dehydrogenase found in the mitochondria. It plays a role in intermediary metabolism and energy production. This protein may tightly associate or interact with the pyruvate dehydrogenase complex.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47804
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32259
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB110-61646
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-42210
Species: Hu
Applications: WB, Flow, IHC, IHC-P
AF2988
Species: Mu, Rt
Applications: WB
NBP2-32104
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB100-168
Species: Hu, Mu(-)
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, Flow-IC
H00171023-M05
Species: Hu
Applications: WB, ELISA
NBP1-32398
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-34980
Species: Hu
NBP1-54755
Species: Hu
Applications: WB
NBP1-87069
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-45978
Species: Hu
Applications: WB, Flow, IHC
NBP2-01506
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-02615
Species: Hu, Mk, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-65214
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-31589
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00003418-M01
Species: Hu
Applications: WB, ELISA, IHC-P

Publications for IDH2 Antibody (H00003418-M01)(3)

Reviews for IDH2 Antibody (H00003418-M01) (0)

There are no reviews for IDH2 Antibody (H00003418-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IDH2 Antibody (H00003418-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IDH2 Products

Bioinformatics Tool for IDH2 Antibody (H00003418-M01)

Discover related pathways, diseases and genes to IDH2 Antibody (H00003418-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IDH2 Antibody (H00003418-M01)

Discover more about diseases related to IDH2 Antibody (H00003418-M01).
 

Pathways for IDH2 Antibody (H00003418-M01)

View related products by pathway.

PTMs for IDH2 Antibody (H00003418-M01)

Learn more about PTMs related to IDH2 Antibody (H00003418-M01).

Blogs on IDH2

There are no specific blogs for IDH2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IDH2 Antibody (5F11) and receive a gift card or discount.

Bioinformatics

Gene Symbol IDH2
Entrez
OMIM
Uniprot