ICT Antibody

Images

 
Western Blot: ICT Antibody [NBP1-87963] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: ICT Antibody [NBP1-87963] - Staining of human rectum shows cytoplasmic positivity in glandular cells.
Western Blot: ICT Antibody [NBP1-87963] - Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 17. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ICT Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TEFKSIYSLDKLYPESQGSDTAWRVPNGAKQADSDIPLDRLTISYCRSSGPGGQNVNKVNSKAEVRFHLATAEWIAEPVRQKIAITHKNKINRLGELILTSESSRYQFRNLADCLQKIRDMI
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ICT1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ICT Protein (NBP1-87963PEP)
Publications
Read Publication using NBP1-87963.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ICT Antibody

  • Digestion substraction 1
  • DS-1DS1
  • EC 3.1.1.29
  • Immature colon carcinoma transcript 1 protein
  • immature colon carcinoma transcript 1
  • peptidyl-tRNA hydrolase ICT1, mitochondrial

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82525
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP1-86687
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-82648
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84975
Species: Hu
Applications: WB, IHC, IHC-P
MAB3657
Species: Hu
Applications: CyTOF-ready, ICFlow
NB110-61646
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
30230002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-84957
Species: Hu
Applications: WB, IHC, IHC-P
H00000518-R01
Species: Hu
NBP1-86636
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-03107
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
NBP1-84037
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4309
Species: Hu, Mu
Applications: WB, IHC, ICC
AF5866
Species: Hu
Applications: WB, IHC
NBP1-82845
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ICT Antibody (NBP1-87963)(1)

Reviews for ICT Antibody (NBP1-87963) (0)

There are no reviews for ICT Antibody (NBP1-87963). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ICT Antibody (NBP1-87963) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ICT Products

Bioinformatics Tool for ICT Antibody (NBP1-87963)

Discover related pathways, diseases and genes to ICT Antibody (NBP1-87963). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ICT Antibody (NBP1-87963)

Discover more about diseases related to ICT Antibody (NBP1-87963).
 

Pathways for ICT Antibody (NBP1-87963)

View related products by pathway.

PTMs for ICT Antibody (NBP1-87963)

Learn more about PTMs related to ICT Antibody (NBP1-87963).

Blogs on ICT

There are no specific blogs for ICT, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ICT Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ICT1