ICOS Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ICOS Source: E.coli
Amino Acid Sequence: INGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKGSGNTVSIK Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
ICOS |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10-100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-21257. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
24 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for ICOS Recombinant Protein Antigen
Background
The C398.4A antibody reacts with the human, mouse and rat 47-57 kD ICOS protein, also known as inducible costimulatory molecule and H4. This protein is homologous to the CD28/CTLA-4 proteins. ICOS is expressed on activated T cells and a subset of thymocytes. It is able to costimulate T cells proliferation. In addition, ICOS is involved in humoral immune responses (B cell germinal center formation). The ICOS ligand is B7h/B7RP-1 or B7-H2. ICOS stimulation has been shown to potentiate TCR-mediated IL-4 and IL-10 production and has been proposed to play a role in Th2 cell development. The C398.4A antibody is useful for flow cytometric analysis and is able to costimulate T cell activation and proliferation.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, Flow, Neut
Species: Hu
Applications: AgAct, ICC, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, IHC, Neut
Species: Mu
Applications: ELISA
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: Block, CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, IHC, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Mu
Applications: BA
Species: Hu
Applications: BA
Species: Bv, Hu, Mu, Rt
Applications: Dual ISH-IHC, Flow, IB, ICC/IF, IHC, IHC-P, IP, Single-Cell Western, WB
Species: Hu, Mu
Applications: IHC, WB
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, Neut, WB
Species: Hu
Applications: CyTOF-reported, Flow, ICC, IHC, Neut
Publications for ICOS Recombinant Protein Antigen (NBP3-21257PEP) (0)
There are no publications for ICOS Recombinant Protein Antigen (NBP3-21257PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ICOS Recombinant Protein Antigen (NBP3-21257PEP) (0)
There are no reviews for ICOS Recombinant Protein Antigen (NBP3-21257PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for ICOS Recombinant Protein Antigen (NBP3-21257PEP) (0)
Additional ICOS Products
Research Areas for ICOS Recombinant Protein Antigen (NBP3-21257PEP)
Find related products by research area.
|
Blogs on ICOS