We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

ICOS Recombinant Protein Antigen

Images

 
There are currently no images for ICOS Recombinant Protein Antigen (NBP3-21257PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ICOS Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ICOS

Source: E.coli

Amino Acid Sequence: INGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKGSGNTVSIK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ICOS
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-21257. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ICOS Recombinant Protein Antigen

  • Activation-inducible lymphocyte immunomediatory molecule
  • AILIM
  • AILIMCD278
  • CD278 antigen
  • CD278
  • CRP-1
  • CVID1
  • ICOS
  • inducible costimulator
  • inducible T-cell costimulator
  • inducible T-cell co-stimulator
  • MGC39850

Background

The C398.4A antibody reacts with the human, mouse and rat 47-57 kD ICOS protein, also known as inducible costimulatory molecule and H4. This protein is homologous to the CD28/CTLA-4 proteins. ICOS is expressed on activated T cells and a subset of thymocytes. It is able to costimulate T cells proliferation. In addition, ICOS is involved in humoral immune responses (B cell germinal center formation). The ICOS ligand is B7h/B7RP-1 or B7-H2. ICOS stimulation has been shown to potentiate TCR-mediated IL-4 and IL-10 production and has been proposed to play a role in Th2 cell development. The C398.4A antibody is useful for flow cytometric analysis and is able to costimulate T cell activation and proliferation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

7268-CT
Species: Hu
Applications: BA
MAB165
Species: Hu
Applications: CyTOF-ready, Flow, Neut
MAB342
Species: Hu
Applications: AgAct, ICC, WB
NBP2-79709
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
MAB140
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, IHC, Neut
DY417
Species: Mu
Applications: ELISA
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
6507-IL/CF
Species: Hu
Applications: BA
202-IL
Species: Hu
Applications: BA
AF1086
Species: Hu
Applications: Block, CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, IHC, WB
NBP2-25208
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, KO, Simple Western, WB
DCDL40
Species: Hu
Applications: ELISA
485-MI
Species: Mu
Applications: BA
NB100-39002
Species: Bv, Hu, Mu, Rt
Applications: Dual ISH-IHC, Flow, IB, ICC/IF, IHC,  IHC-P, IP, Single-Cell Western, WB
MAB7158
Species: Hu, Mu
Applications: IHC, WB
NBP1-49045
Species: Mu
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, InhibTFunc
AF594
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, Neut, WB
MAB190
Species: Hu
Applications: CyTOF-reported, Flow, ICC, IHC, Neut

Publications for ICOS Recombinant Protein Antigen (NBP3-21257PEP) (0)

There are no publications for ICOS Recombinant Protein Antigen (NBP3-21257PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ICOS Recombinant Protein Antigen (NBP3-21257PEP) (0)

There are no reviews for ICOS Recombinant Protein Antigen (NBP3-21257PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ICOS Recombinant Protein Antigen (NBP3-21257PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ICOS Products

Research Areas for ICOS Recombinant Protein Antigen (NBP3-21257PEP)

Find related products by research area.

Blogs on ICOS

There are no specific blogs for ICOS, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ICOS Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ICOS