ICEBERG Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

ICEBERG Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ICEBERG.
  
  

  Source: E. coli

  Amino Acid Sequence: DTVMDKARVLIDLVTGKGPKSCCKFIKHLCEEDPQLASKMGLH

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: CARD18
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-48688.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 22 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ICEBERG Recombinant Protein Antigen

• caspase recruitment domain family, member 18
• Caspase-1 inhibitor Iceberg
• ICEBERG caspase-1 inhibitor
• ICEBERGcaspase recruitment domain-containing protein 18
• pseudo-ICE
• UNQ5804

Background

ICEBERG, also known as Caspase recruitment domain-containing protein 18, is a 90 amino acid protein that is 10 kDa, most often expressed in the heart and placenta, down-regulates the release of IL1B, and by interacting with caspase-1 and preventing its association with RIP2 inhibits the generation of IL-1-beta. This protein is being studied for its involvement in chronic lymphocytic leukemia. The ICEBERG protein has been linked to the NOD-like receptor signaling pathway where it interacts with CASP1, CARD8, CARD16, and CARD17.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: CARD18