ICAM-4 Antibody

Images

 
Western Blot: ICAM-4 Antibody [H00003386-D01P] - Analysis of ICAM4 expression in transfected 293T cell line by ICAM4 polyclonal antibody.Lane 1: ICAM4 transfected lysate(29.60 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ICAM-4 Antibody Summary

Immunogen
ICAM4 (NP_001034221.1, 1 a.a. - 272 a.a.) full-length human protein. MGSLFPLSLLFFLAAAYPGVGSALGRRTKRAQSPKGSPLAPSGTSVPFWVRMSPEFVAVQPGKSVQLNCSNSCPQPQNSSLRTPLRQGKTLRGPGWVSYQLLDVRAWSSLAHCLVTCAGKTRWATSRITAYSVPGGLLGGDPEAWKPGHLFRKPGALHRPGSGQRDLDLRVCCWTPRLLAARDLPRAPQSRRPGGPQQLGTHYTDARLEPRAHSFGLRFHRCPCRDPPHCGRCVPMQVPSYEVPGVKGDVLCRLSEKKRNMKQSGEMAIHGG
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ICAM4
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ICAM-4 Antibody

  • CD242 antigen
  • CD242
  • ICAM4
  • ICAM-4
  • intercellular adhesion molecule 4 (Landsteiner-Wiener blood group)
  • intercellular adhesion molecule 4 (LW blood group)
  • intercellular adhesion molecule 4
  • intercellular adhesion molecule 4, Landsteiner-Wiener blood group
  • Landsteiner-Wiener blood group antigen a
  • Landsteiner-Wiener blood group glycoprotein
  • Landsteiner-Wiener blood group
  • LWLW blood group protein

Background

This gene encodes the Landsteiner-Wiener (LW) blood group antigen(s) that belongs to the immunoglobulin (Ig) superfamily, and that shares similarity with the intercellular adhesion molecule (ICAM) protein family. This ICAM protein contains 2 Ig-like C2-type domains and binds to the leukocyte adhesion LFA-1 protein. The molecular basis of the LW(A)/LW(B) blood group antigens is a single aa variation at position 100; Gln-100=LW(A) and Arg-100=LW(B). Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-69668
Species: Hu
Applications: WB
NBP2-07087
Species: Hu
AF7179
Species: Hu
Applications: WB, Simple Western, Flow, CyTOF-ready
NBP2-31106
Species: Hu
Applications: WB, Flow, IHC, IHC-P, IP, CyTOF-ready, Flow-CS
NBP2-49180
Species: Hu
Applications: IHC
MAB6967
Species: Hu
Applications: WB
AF1173
Species: Mu, Rt
Applications: WB, IHC
NB200-610
Species: Hu, Ca, GP
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
796-IC
Species: Mu
NB500-328
Species: Hu
Applications: Flow, IP, CyTOF-ready
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB244
Species: Hu
Applications: WB
NB110-89474
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for ICAM-4 Antibody (H00003386-D01P) (0)

There are no publications for ICAM-4 Antibody (H00003386-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ICAM-4 Antibody (H00003386-D01P) (0)

There are no reviews for ICAM-4 Antibody (H00003386-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ICAM-4 Antibody (H00003386-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ICAM-4 Products

Bioinformatics Tool for ICAM-4 Antibody (H00003386-D01P)

Discover related pathways, diseases and genes to ICAM-4 Antibody (H00003386-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ICAM-4 Antibody (H00003386-D01P)

Discover more about diseases related to ICAM-4 Antibody (H00003386-D01P).
 

Pathways for ICAM-4 Antibody (H00003386-D01P)

View related products by pathway.

PTMs for ICAM-4 Antibody (H00003386-D01P)

Learn more about PTMs related to ICAM-4 Antibody (H00003386-D01P).

Blogs on ICAM-4

There are no specific blogs for ICAM-4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ICAM-4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ICAM4
Entrez
Uniprot