ICA1 Antibody (6G11)

Images

 
Western Blot: ICA1 Antibody (6G11) [H00003382-M01] - Analysis of ICA1 expression in transfected 293T cell line by ICA1 monoclonal antibody (M01), clone 6G11.Lane 1: ICA1 transfected lysate (Predicted MW: 54.6 KDa).Lane ...read more
Sandwich ELISA: ICA1 Antibody (6G11) [H00003382-M01] - Detection limit for recombinant GST tagged ICA1 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
6G11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ICA1 Antibody (6G11) Summary

Immunogen
ICA1 (NP_071682, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSGHKCSYPWDLQDRYAQDKSVVNKMQQKYWETKQAFIKATGKKEDEHVVASDADLDAKLELFHSIQRTCLDLSKAIVLYQKRICFLSQEENELGKFLRSQGFQDKTRAG
Localization
Cell Membrane, Cytoplasmic and Golgi Apparatus
Specificity
ICA1 - islet cell autoantigen 1, 69kDa
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ICA1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ICA1 Antibody (6G11)

  • diabetes mellitus type I autoantigen
  • ICA1
  • ICA69
  • ICAp69
  • ICAp69Islet cell autoantigen p69,69 kDa islet cell autoantigen
  • islet cell autoantigen 1 (69kD)
  • islet cell autoantigen 1 isoform
  • islet cell autoantigen 1
  • islet cell autoantigen 1, 69kDa
  • p69

Background

This gene encodes a protein with an arfaptin homology domain that is found both in the cytosol and as membrane-bound form on the Golgi complex and immature secretory granules. This protein is believed to be an autoantigen in insulin-dependent diabetes mellitus and primary Sjogren's syndrome. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP1-90044
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-33284
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-47842
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, IP, WB
AF1916
Species: Hu
Applications: ICC, IHC, WB
NBP1-84022
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
409-ML/CF
Species: Mu
Applications: BA
NBP2-21577
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, WB
H00001523-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NBP1-81796
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-32956
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-38780
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-79854
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, PA, WB
NBP1-47974
Species: Ca, Hu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF1334
Species: Hu
Applications: IHC, WB
NB110-41404
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NB100-74648
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-85841
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00003382-M01
Species: Hu
Applications: WB, ELISA, S-ELISA

Publications for ICA1 Antibody (H00003382-M01) (0)

There are no publications for ICA1 Antibody (H00003382-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ICA1 Antibody (H00003382-M01) (0)

There are no reviews for ICA1 Antibody (H00003382-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ICA1 Antibody (H00003382-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ICA1 Products

Bioinformatics Tool for ICA1 Antibody (H00003382-M01)

Discover related pathways, diseases and genes to ICA1 Antibody (H00003382-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ICA1 Antibody (H00003382-M01)

Discover more about diseases related to ICA1 Antibody (H00003382-M01).
 

Pathways for ICA1 Antibody (H00003382-M01)

View related products by pathway.

PTMs for ICA1 Antibody (H00003382-M01)

Learn more about PTMs related to ICA1 Antibody (H00003382-M01).
 

Research Areas for ICA1 Antibody (H00003382-M01)

Find related products by research area.

Blogs on ICA1

There are no specific blogs for ICA1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ICA1 Antibody (6G11) and receive a gift card or discount.

Bioinformatics

Gene Symbol ICA1
Entrez
OMIM
Uniprot