![Western Blot: hydroxysteroid (17-beta) dehydrogenase 11 Antibody [NBP1-90334] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Hep-G2](http://images.novusbio.com/fullsize/hydroxysteroid-17-beta-dehydrogenase-11-Antibody-Western-Blot-NBP1-90334-img0004.jpg "Western Blot: hydroxysteroid (17-beta) dehydrogenase 11 Antibody [NBP1-90334] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Hep-G2")
| Reactivity | HuSpecies Glossary |
| Applications | WB, Simple Western, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FVNTGFIKNPSTSLGPTLEPEEVVNRLMHGILTEQKMIFIPSSIAFLTTLERILPERFLAVLKRKISVKFDAVIGY |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | HSD17B11 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. See Simple Western Antibody Database for Simple Western validation: Tested in HepG2 lysate, separated by Size, antibody dilution of 1:25, apparent MW was 36 kDa. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot 17 beta-HSD1/HSD17B1 Antibody [Unconjugated]](https://images.novusbio.com/images2/17_beta-HSD1_AF7178_Western_Blot_11632.jpg)
![Immunohistochemistry 17 beta-HSD1/HSD17B1 Antibody [Unconjugated]](https://images.novusbio.com/images2/17_betaHSD1_AF7178_Immunohistochemistry_22701.jpg)
![Simple Western 17 beta-HSD1/HSD17B1 Antibody [Unconjugated]](https://images.novusbio.com/images2/af7178_human-17-beta-hsd1-hsd17b1-affinity-purified-polyclonal-ab-simple-western-1342022125637.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for hydroxysteroid (17-beta) dehydrogenase 11 Antibody (NBP1-90334)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | HSD17B11 |
![Immunocytochemistry/Immunofluorescence: hydroxysteroid (17-beta) dehydrogenase 11 Antibody [NBP1-90334] - Staining of human cell line U-2 OS shows localization to lipid droplets. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/hydroxysteroid-17-beta-dehydrogenase-11-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-90334-img0007.jpg "Immunocytochemistry/Immunofluorescence: hydroxysteroid (17-beta) dehydrogenase 11 Antibody [NBP1-90334] - Staining of human cell line U-2 OS shows localization to lipid droplets. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: hydroxysteroid (17-beta) dehydrogenase 11 Antibody [NBP1-90334] - Staining of human kidney shows weak to moderate cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/hydroxysteroid-17-beta-dehydrogenase-11-Antibody-Immunohistochemistry-Paraffin-NBP1-90334-img0013.jpg "Immunohistochemistry-Paraffin: hydroxysteroid (17-beta) dehydrogenase 11 Antibody [NBP1-90334] - Staining of human kidney shows weak to moderate cytoplasmic positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: hydroxysteroid (17-beta) dehydrogenase 11 Antibody [NBP1-90334] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/hydroxysteroid-17-beta-dehydrogenase-11-Antibody-Immunohistochemistry-Paraffin-NBP1-90334-img0002.jpg "Immunohistochemistry-Paraffin: hydroxysteroid (17-beta) dehydrogenase 11 Antibody [NBP1-90334] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: hydroxysteroid (17-beta) dehydrogenase 11 Antibody [NBP1-90334] - Analysis in human small intestine and skeletal muscle tissues. Corresponding HSD17B11 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/hydroxysteroid-17-beta-dehydrogenase-11-Antibody-Immunohistochemistry-Paraffin-NBP1-90334-img0010.jpg "Immunohistochemistry-Paraffin: hydroxysteroid (17-beta) dehydrogenase 11 Antibody [NBP1-90334] - Analysis in human small intestine and skeletal muscle tissues. Corresponding HSD17B11 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: hydroxysteroid (17-beta) dehydrogenase 11 Antibody [NBP1-90334] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/hydroxysteroid-17-beta-dehydrogenase-11-Antibody-Immunohistochemistry-Paraffin-NBP1-90334-img0011.jpg "Immunohistochemistry-Paraffin: hydroxysteroid (17-beta) dehydrogenase 11 Antibody [NBP1-90334] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
![Immunohistochemistry-Paraffin: hydroxysteroid (17-beta) dehydrogenase 11 Antibody [NBP1-90334] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/hydroxysteroid-17-beta-dehydrogenase-11-Antibody-Immunohistochemistry-Paraffin-NBP1-90334-img0012.jpg "Immunohistochemistry-Paraffin: hydroxysteroid (17-beta) dehydrogenase 11 Antibody [NBP1-90334] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: hydroxysteroid (17-beta) dehydrogenase 11 Antibody [NBP1-90334] - Staining of human duodenum shows moderate to strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/hydroxysteroid-17-beta-dehydrogenase-11-Antibody-Immunohistochemistry-Paraffin-NBP1-90334-img0014.jpg "Immunohistochemistry-Paraffin: hydroxysteroid (17-beta) dehydrogenase 11 Antibody [NBP1-90334] - Staining of human duodenum shows moderate to strong cytoplasmic positivity in glandular cells.")
![Simple Western: hydroxysteroid (17-beta) dehydrogenase 11 Antibody [NBP1-90334] - Simple Western: hydroxysteroid (17-beta) dehydrogenase 11 Antibody [NBP1-90334] - Simple Western lane view shows a specific band for hydroxysteroid (17-beta) dehydrogenase 11 in 0.2 mg/ml of HepG2 lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation system.](http://images.novusbio.com/fullsize/hydroxysteroid-17-beta-dehydrogenase-11-Antibody-Simple-Western-NBP1-90334-img0008.jpg "Simple Western: hydroxysteroid (17-beta) dehydrogenase 11 Antibody [NBP1-90334] - Simple Western: hydroxysteroid (17-beta) dehydrogenase 11 Antibody [NBP1-90334] - Simple Western lane view shows a specific band for hydroxysteroid (17-beta) dehydrogenase 11 in 0.2 mg/ml of HepG2 lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation system.")
![Simple Western: hydroxysteroid (17-beta) dehydrogenase 11 Antibody [NBP1-90334] - Simple Western: hydroxysteroid (17-beta) dehydrogenase 11 Antibody [NBP1-90334] - Electropherogram image of the corresponding Simple Western lane view. hydroxysteroid (17-beta) dehydrogenase 11 antibody was used at 1:25 dilution on HepG2 lysate(s) respectively.](http://images.novusbio.com/fullsize/hydroxysteroid-17-beta-dehydrogenase-11-Antibody-Simple-Western-NBP1-90334-img0009.jpg "Simple Western: hydroxysteroid (17-beta) dehydrogenase 11 Antibody [NBP1-90334] - Simple Western: hydroxysteroid (17-beta) dehydrogenase 11 Antibody [NBP1-90334] - Electropherogram image of the corresponding Simple Western lane view. hydroxysteroid (17-beta) dehydrogenase 11 antibody was used at 1:25 dilution on HepG2 lysate(s) respectively.")
![Western Blot Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) - BSA Free](https://images.novusbio.com/images/Androgen-R-NR3C4-p-Ser213-p-Ser210-Antibody-156C135-2-Western-Blot-NB100-56603-img0004.jpg)
![Bioactivity TGF-beta 1 [Unconjugated]](https://images.novusbio.com/images/protein/7754-bhcf_recombinant-human-tgf-beta-1-human-cell-expressed-cf-bioactivity-1811202013946.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")