hydroxysteroid (17-beta) dehydrogenase 11 Antibody


Western Blot: hydroxysteroid (17-beta) dehydrogenase 11 Antibody [NBP1-90334] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Hep-G2
Immunocytochemistry/ Immunofluorescence: hydroxysteroid (17-beta) dehydrogenase 11 Antibody [NBP1-90334] - Staining of human cell line U-2 OS shows localization to lipid droplets.
Immunohistochemistry-Paraffin: hydroxysteroid (17-beta) dehydrogenase 11 Antibody [NBP1-90334] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.
Simple Western: hydroxysteroid (17-beta) dehydrogenase 11 Antibody [NBP1-90334] - Simple Western: hydroxysteroid (17-beta) dehydrogenase 11 Antibody [NBP1-90334] - Simple Western lane view shows a specific band for ...read more
Simple Western: hydroxysteroid (17-beta) dehydrogenase 11 Antibody [NBP1-90334] - Simple Western: hydroxysteroid (17-beta) dehydrogenase 11 Antibody [NBP1-90334] - Electropherogram image of the corresponding Simple ...read more

Product Details

Reactivity HuSpecies Glossary
Applications WB, Simple Western, ICC/IF, IHC, IHC-P

Order Details

hydroxysteroid (17-beta) dehydrogenase 11 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: FVNTGFIKNPSTSLGPTLEPEEVVNRLMHGILTEQKMIFIPSSIAFLTTLERILPERFLAVLKRKISVKFDAVIGY
Specificity of human hydroxysteroid (17-beta) dehydrogenase 11 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Simple Western
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size.
Control Peptide
hydroxysteroid (17-beta) dehydrogenase 11 Protein (NBP1-90334PEP)
Read Publication using NBP1-90334.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (80%), Rat (80%). Reactivity reported in scientific literature (PMID: 23227862)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for hydroxysteroid (17-beta) dehydrogenase 11 Antibody

  • 17betaHSD11
  • 17betaHSDXI
  • 17-beta-hydroxysteroid dehydrogenase 11
  • 17-beta-hydroxysteroid dehydrogenase type XI
  • 17-beta-hydroxysteroid dehydrogenase XI
  • 17bHSD11
  • CTCL-associated antigen HD-CL-03
  • dehydrogenase/reductase (SDR family) member 8
  • DHRS8
  • EC 1.1.1
  • EC
  • hydroxysteroid (17-beta) dehydrogenase 11
  • member 2,17-beta-HSD 11
  • retSDR2
  • SDR16C2,17BHSD11
  • T-cell lymphoma-associated antigen HD-CL-03,17-beta-HSD XI


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Mk
Applications: WB, ChIP, DB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Pm
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, Simple Western
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IP, DirELISA
Species: Hu
Applications: WB, IHC, IF
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P

Publications for hydroxysteroid (17-beta) dehydrogenase 11 Antibody (NBP1-90334)(1)

Reviews for hydroxysteroid (17-beta) dehydrogenase 11 Antibody (NBP1-90334) (0)

There are no reviews for hydroxysteroid (17-beta) dehydrogenase 11 Antibody (NBP1-90334). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for hydroxysteroid (17-beta) dehydrogenase 11 Antibody (NBP1-90334) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional hydroxysteroid (17-beta) dehydrogenase 11 Products

Bioinformatics Tool for hydroxysteroid (17-beta) dehydrogenase 11 Antibody (NBP1-90334)

Discover related pathways, diseases and genes to hydroxysteroid (17-beta) dehydrogenase 11 Antibody (NBP1-90334). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for hydroxysteroid (17-beta) dehydrogenase 11 Antibody (NBP1-90334)

Discover more about diseases related to hydroxysteroid (17-beta) dehydrogenase 11 Antibody (NBP1-90334).

Pathways for hydroxysteroid (17-beta) dehydrogenase 11 Antibody (NBP1-90334)

View related products by pathway.

Research Areas for hydroxysteroid (17-beta) dehydrogenase 11 Antibody (NBP1-90334)

Find related products by research area.

Blogs on hydroxysteroid (17-beta) dehydrogenase 11

There are no specific blogs for hydroxysteroid (17-beta) dehydrogenase 11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our hydroxysteroid (17-beta) dehydrogenase 11 Antibody and receive a gift card or discount.


Gene Symbol HSD17B11