hydroxysteroid (17-beta) dehydrogenase 11 Antibody

Images

 
Western Blot: hydroxysteroid (17-beta) dehydrogenase 11 Antibody [NBP1-90334] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Hep-G2
Immunocytochemistry/ Immunofluorescence: hydroxysteroid (17-beta) dehydrogenase 11 Antibody [NBP1-90334] - Staining of human cell line U-2 OS shows localization to lipid droplets.
Immunohistochemistry-Paraffin: hydroxysteroid (17-beta) dehydrogenase 11 Antibody [NBP1-90334] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.
Simple Western: hydroxysteroid (17-beta) dehydrogenase 11 Antibody [NBP1-90334] - Simple Western: hydroxysteroid (17-beta) dehydrogenase 11 Antibody [NBP1-90334] - Simple Western lane view shows a specific band for ...read more
Simple Western: hydroxysteroid (17-beta) dehydrogenase 11 Antibody [NBP1-90334] - Simple Western: hydroxysteroid (17-beta) dehydrogenase 11 Antibody [NBP1-90334] - Electropherogram image of the corresponding Simple ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, Simple Western, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

hydroxysteroid (17-beta) dehydrogenase 11 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:FVNTGFIKNPSTSLGPTLEPEEVVNRLMHGILTEQKMIFIPSSIAFLTTLERILPERFLAVLKRKISVKFDAVIGY
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HSD17B11
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Simple Western
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size.
Control Peptide
hydroxysteroid (17-beta) dehydrogenase 11 Protein (NBP1-90334PEP)
Publications
Read Publication using NBP1-90334.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (80%), Rat (80%). Reactivity reported in scientific literature (PMID: 23227862)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for hydroxysteroid (17-beta) dehydrogenase 11 Antibody

  • 17betaHSD11
  • 17betaHSDXI
  • 17-beta-hydroxysteroid dehydrogenase 11
  • 17-beta-hydroxysteroid dehydrogenase type XI
  • 17-beta-hydroxysteroid dehydrogenase XI
  • 17bHSD11
  • CTCL-associated antigen HD-CL-03
  • dehydrogenase/reductase (SDR family) member 8
  • DHRS8
  • EC 1.1.1
  • EC 1.1.1.62
  • hydroxysteroid (17-beta) dehydrogenase 11
  • member 2,17-beta-HSD 11
  • PAN1BRETSDR2,17-BETA-HSD11
  • retSDR2
  • RetSDR2,17-BETA-HSDXI
  • SDR16C2,17BHSD11
  • T-cell lymphoma-associated antigen HD-CL-03,17-beta-HSD XI

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP2-02164
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-30446
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB200-305
Species: Hu, Mu, Mk
Applications: WB, ChIP, DB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
H00055835-M02
Species: Hu
Applications: WB, ELISA, IP
NBP1-82847
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-94148
Species: Hu
Applications: IHC, IHC-P
MAB7178
Species: Hu
Applications: WB, Simple Western
NBP1-92011
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
PP-H4537-00
Species: Hu
Applications: WB, IHC, IP, DirELISA
NBP2-46005
Species: Hu
Applications: WB, IHC, IF
H00152503-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-19010
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85630
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-90334
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P

Publications for hydroxysteroid (17-beta) dehydrogenase 11 Antibody (NBP1-90334)(1)

Reviews for hydroxysteroid (17-beta) dehydrogenase 11 Antibody (NBP1-90334) (0)

There are no reviews for hydroxysteroid (17-beta) dehydrogenase 11 Antibody (NBP1-90334). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for hydroxysteroid (17-beta) dehydrogenase 11 Antibody (NBP1-90334) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional hydroxysteroid (17-beta) dehydrogenase 11 Products

Bioinformatics Tool for hydroxysteroid (17-beta) dehydrogenase 11 Antibody (NBP1-90334)

Discover related pathways, diseases and genes to hydroxysteroid (17-beta) dehydrogenase 11 Antibody (NBP1-90334). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for hydroxysteroid (17-beta) dehydrogenase 11 Antibody (NBP1-90334)

Discover more about diseases related to hydroxysteroid (17-beta) dehydrogenase 11 Antibody (NBP1-90334).
 

Pathways for hydroxysteroid (17-beta) dehydrogenase 11 Antibody (NBP1-90334)

View related products by pathway.

Research Areas for hydroxysteroid (17-beta) dehydrogenase 11 Antibody (NBP1-90334)

Find related products by research area.

Blogs on hydroxysteroid (17-beta) dehydrogenase 11

There are no specific blogs for hydroxysteroid (17-beta) dehydrogenase 11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our hydroxysteroid (17-beta) dehydrogenase 11 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HSD17B11