UGT2A1 Antibody - BSA Free

Immunohistochemistry-Paraffin: UGT2A1 Antibody [NBP1-94148] -Staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: UGT2A1 Antibody [NBP1-94148] -Staining of human kidney shows weak cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: UGT2A1 Antibody [NBP1-94148] -Staining of human skeletal muscle shows weak cytoplasmic positivity in myocytes.

Immunohistochemistry-Paraffin: UGT2A1 Antibody [NBP1-94148] -Staining of human lymph node shows no positivity in non-germinal center cells as expected.

Staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.

Staining of human lymph node shows no positivity in non-germinal center cells as expected.

Staining of human kidney shows weak cytoplasmic positivity in cells in tubules.

Staining of human skeletal muscle shows weak cytoplasmic positivity in myocytes.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

UGT2A1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KEHNVTVLVASGALFITPTSNPSLTFEIYKVPFGKERIEGVIKDFVLTWLENRPSPSTIWRFYQEMAKVIKDFHMVSQEICDGVLKNQQLMAKLKKSKFEVLVSDPVFPCGDIVALKLGIPFMYS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: UGT2A1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  UGT2A1 Recombinant Protein Antigen (NBP1-94148PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%), Rat (83%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for UGT2A1 Antibody - BSA Free

• UDP glucuronosyltransferase 2 family, polypeptide A1, complex locus
• UDP glycosyltransferase 2 family, polypeptide A1
• UDP-glucuronosyltransferase 2A1
• UDPGT2A1
• uridine diphosphate glycosyltransferase 2 family, member A1

Background

The protein encoded by this gene belongs to the UDP-glycosyltransferase family. Members of this protein family play a role in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds. The encoded enzyme is expressed in the olfactory neuroepithelium, which lines the posterior nasal cavity and is exposed to a wide range of odorants and airborne toxic compounds. Hence, this protein has been suggested to be involved in clearing lipophilic odorant molecules from the sensory epithelium. This gene shares exon structure with the UDP glucuronosyltransferase 2A2 family member, which encodes N-terminally distinct isoforms. Polymorphisms in this gene may be associated with the loss of taste and smell that is reported by some individuals during SARS-CoV-2 infection.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: UGT2A1