Hydrogen Potassium ATPase Beta Antibody

Images

 
Immunohistochemistry: Hydrogen Potassium ATPase Beta Antibody [NBP2-32035] - Staining of human stomach, lower shows strong cytoplasmic positivity in subset of glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Hydrogen Potassium ATPase Beta Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: TPDYQDQLRSPGVTLRPDVYGEKGLEIVYNVSDNRTWADLTQTLHAFLAGYSPAAQEDSINCTSEQYFFQESFRAPNHTKFSCKFTADML
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATP4B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Hydrogen Potassium ATPase Beta Protein (NBP2-32035PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (83%), Rat (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Hydrogen Potassium ATPase Beta Antibody

  • ATP6B
  • ATPase, H+/K+ exchanging, beta polypeptide
  • ATPase, H+/K+ transporting, beta polypeptide
  • Gastric H(+)/K(+) ATPase subunit beta
  • gastric H+/K+ ATPase beta subunit
  • gastric hydrogen-potassium ATPase, beta
  • potassium-transporting ATPase beta chain
  • potassium-transporting ATPase subunit beta
  • Proton pump beta chain

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88889
Species: Hu
Applications: IHC, IHC-P
NBP1-92180
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP1-33284
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP2-32887
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, PAGE, IF
NBP1-50811
Species: Hu
Applications: WB, ELISA, IA, S-ELISA
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
NB100-65214
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-33870
Species: Hu, Fe
Applications: ICC/IF, IHC, IHC-P
NBP2-16679
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB600-1182
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP1-91996
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-90312
Species: Hu
Applications: IHC, IHC-P
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
AF2097
Species: Hu
Applications: WB, ChIP, ICC
NB100-56630
Species: Hu
Applications: WB
NBP2-32035
Species: Hu
Applications: IHC, IHC-P

Publications for Hydrogen Potassium ATPase Beta Antibody (NBP2-32035) (0)

There are no publications for Hydrogen Potassium ATPase Beta Antibody (NBP2-32035).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Hydrogen Potassium ATPase Beta Antibody (NBP2-32035) (0)

There are no reviews for Hydrogen Potassium ATPase Beta Antibody (NBP2-32035). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Hydrogen Potassium ATPase Beta Antibody (NBP2-32035) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Hydrogen Potassium ATPase Beta Products

Bioinformatics Tool for Hydrogen Potassium ATPase Beta Antibody (NBP2-32035)

Discover related pathways, diseases and genes to Hydrogen Potassium ATPase Beta Antibody (NBP2-32035). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Hydrogen Potassium ATPase Beta Antibody (NBP2-32035)

Discover more about diseases related to Hydrogen Potassium ATPase Beta Antibody (NBP2-32035).
 

Pathways for Hydrogen Potassium ATPase Beta Antibody (NBP2-32035)

View related products by pathway.

Blogs on Hydrogen Potassium ATPase Beta

There are no specific blogs for Hydrogen Potassium ATPase Beta, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Hydrogen Potassium ATPase Beta Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP4B
Uniprot