ATP4A Antibody

Images

 
Immunohistochemistry-Paraffin: ATP4A Antibody [NBP1-88889] - Staining of human stomach shows strong cytoplasmic positivity in parietal cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ATP4A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TDYFTAMAQEGWFPLLCVGLRAQWEDHHLQDLQDSYGQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATP4A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ATP4A Protein (NBP1-88889PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ATP4A Antibody

  • ATP6Agastric H
  • ATPase, H+/K+ exchanging, alpha polypeptide
  • ATPase, H+/K+ transporting, alpha polypeptide
  • EC 3.6.3
  • EC 3.6.3.10
  • gastric H
  • Gastric H(+)/K(+) ATPase subunit alpha
  • gastric H+/K+ ATPase alpha subunit
  • gastric hydrogen-potassium ATPase
  • H(+)-K(+)-ATPase alpha subunit
  • K-ATPase alpha subunit
  • K-ATPase catalytic subunit
  • potassium-transporting ATPase alpha chain 1
  • Proton pump

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-32887
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, PAGE, IF
NB300-583
Species: Hu, Mu, Rt, Po, Bv, Ca, Ft, Rb
Applications: WB, ChIP, DB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ICC, IF
MAB2358
Species: Hu, Mu
Applications: IHC, ICC
NB100-65214
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-16679
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-76917
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-56348
Species: Hu
Applications: ICC/IF
NBP1-82493
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-82486
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF3129
Species: Hu
Applications: WB, IHC, IP
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89130
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-05163
Species: Hu, Rt, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-85497
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-42378
Species: Hu
Applications: WB, IHC
NBP1-88889
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for ATP4A Antibody (NBP1-88889) (0)

There are no publications for ATP4A Antibody (NBP1-88889).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATP4A Antibody (NBP1-88889) (0)

There are no reviews for ATP4A Antibody (NBP1-88889). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ATP4A Antibody (NBP1-88889) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ATP4A Products

Bioinformatics Tool for ATP4A Antibody (NBP1-88889)

Discover related pathways, diseases and genes to ATP4A Antibody (NBP1-88889). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATP4A Antibody (NBP1-88889)

Discover more about diseases related to ATP4A Antibody (NBP1-88889).
 

Pathways for ATP4A Antibody (NBP1-88889)

View related products by pathway.

PTMs for ATP4A Antibody (NBP1-88889)

Learn more about PTMs related to ATP4A Antibody (NBP1-88889).

Blogs on ATP4A

There are no specific blogs for ATP4A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATP4A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP4A