ATP4A Antibody - BSA Free

Immunohistochemistry-Paraffin: ATP4A Antibody [NBP1-88889] - Staining in human stomach and pancreas tissues using anti-ATP4A antibody. Corresponding ATP4A RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: ATP4A Antibody [NBP1-88889] - Staining of human pancreas shows low expression as expected.

Immunohistochemistry-Paraffin: ATP4A Antibody [NBP1-88889] - Staining of human stomach shows strong cytoplasmic positivity in parietal cells.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ATP4A Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: TDYFTAMAQEGWFPLLCVGLRAQWEDHHLQDLQDSYGQ
• Predicted Species: Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ATP4A
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  ATP4A Protein (NBP1-88889PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ATP4A Antibody - BSA Free

• ATP6Agastric H
• ATPase, H+/K+ exchanging, alpha polypeptide
• ATPase, H+/K+ transporting, alpha polypeptide
• EC 3.6.3
• EC 3.6.3.10
• gastric H
• Gastric H(+)/K(+) ATPase subunit alpha
• gastric H+/K+ ATPase alpha subunit
• gastric hydrogen-potassium ATPase
• H(+)-K(+)-ATPase alpha subunit
• K-ATPase alpha subunit
• K-ATPase catalytic subunit
• potassium-transporting ATPase alpha chain 1
• Proton pump

Background

The protein encoded by the ATP4A gene belongs to a family of P-type cation-transporting ATPases. The gastric H+, K+-ATPase is a heterodimer consisting of a high molecular weight catalytic alpha subunit and a smaller but heavily glycosylated beta subunit. This enzyme is a proton pump that catalyzes the hydrolysis of ATP coupled with the exchange of H(+) and K(+) ions across the plasma membrane. It is also responsible for gastric acid secretion. This gene encodes a catalytic alpha subunit of the gastric H+, K+-ATPase. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ATP4A Antibody (NBP1-88889)(1)

Publication using NBP1-88889

• Sayols S, Klassek J, Werner C et al. Signalling codes for the maintenance and lineage commitment of embryonic gastric epithelial progenitors Development 2020-01-28 [PMID: 32878924] (Immunohistochemistry, Immunohistochemistry-Frozen)

Bioinformatics

• Gene Symbol: ATP4A