Hyaluronan Synthase 3/HAS3 Antibody [CoraFluor™ 1] Summary
Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 67-281 of human Hyaluronan Synthase 3/HAS3 (NP_619515.1).
Sequence: HRRMRRAGQALKLPSPRRGSVALCIAAYQEDPDYLRKCLRSAQRISFPDLKVVMVVDGNRQEDAYMLDIFHEVLGGTEQAGFFVWRSNFHEAGEGETEASLQEGMDRVRDVVRASTFSCIMQKWGGKREVMYTAFKALGDSVDYIQVCDSDTVLDPACTIEMLRVLEEDPQVGGVGGDVQPPGKGMAVEDDQVQAAQVRATEAWSVHQRHVSREQ |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
HAS3 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA
- Immunocytochemistry/ Immunofluorescence
- Western Blot
|
Application Notes |
Optimal dilution of this antibody should be experimentally determined. |
Packaging, Storage & Formulations
Storage |
Store at 4C in the dark. Do not freeze. |
Buffer |
PBS |
Preservative |
No Preservative |
Purity |
Affinity purified |
Notes
CoraFluor (TM) is a trademark of Bio-Techne Corp. Sold for research purposes only under agreement from Massachusetts General Hospital. US patent 2022/0025254
Alternate Names for Hyaluronan Synthase 3/HAS3 Antibody [CoraFluor™ 1]
Background
The protein encoded by the HAS3 gene is involved in the synthesis of the unbranched glycosaminoglycan hyaluronan, orhyaluronic acid, which is a major constituent of the extracellular matrix. This gene is a member of the NODC/HAS genefamily. Compared to the proteins encoded by other members of this gene family, this protein appears to be more of aregulator of hyaluronan synthesis. Two transcript variants encoding different isoforms have been found for this gene.(provided by RefSeq)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: Flow, ICC/IF, IHC, PEP-ELISA
Species: Hu
Applications: BA
Species: Mu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Po, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC, Simple Western, WB
Species: Mu, Rt
Applications: IHC, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Publications for Hyaluronan Synthase 3/HAS3 Antibody (NBP3-35352CL1) (0)
There are no publications for Hyaluronan Synthase 3/HAS3 Antibody (NBP3-35352CL1).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Hyaluronan Synthase 3/HAS3 Antibody (NBP3-35352CL1) (0)
There are no reviews for Hyaluronan Synthase 3/HAS3 Antibody (NBP3-35352CL1).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Hyaluronan Synthase 3/HAS3 Antibody (NBP3-35352CL1) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Hyaluronan Synthase 3/HAS3 Products
Blogs on Hyaluronan Synthase 3/HAS3