Hyaluronan Synthase 3/HAS3 Antibody

Images

 
Western Blot: Hyaluronan Synthase 3/HAS3 Antibody [NBP1-86328] - Lane 1: 50ug mouse whole lung lysate. Lane 2: 75ug mouse whole lung lysate. Lane 3: 50ug mouse brainstem lysate. Antibody at 1:1000. Image submitted by a ...read more
Immunohistochemistry-Paraffin: Hyaluronan Synthase 3/HAS3 Antibody [NBP1-86328] - Staining of human urinary bladder shows moderate to strong positivity in the extracellular matrix.
Immunohistochemistry-Paraffin: Hyaluronan Synthase 3/HAS3 Antibody [NBP1-86328] - Staining of human lung shows moderate positivity in respiratory epithelial cells.
Immunohistochemistry-Paraffin: Hyaluronan Synthase 3/HAS3 Antibody [NBP1-86328] - Staining of human prostate shows moderate to strong positivity in the extracellular matrix.
Immunohistochemistry-Paraffin: Hyaluronan Synthase 3/HAS3 Antibody [NBP1-86328] - Staining of human tonsil shows no positivity in lymphoid cells as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Hyaluronan Synthase 3/HAS3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RQEDAYMLDIFHEVLGGTEQAGFFVWRSNFHEAGEGETEASLQEGMDRVRDVVRASTFSC
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HAS3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in ICC/IF reported in scientific literature (PMID 28287145). Hyaluronan Synthase 3/HAS3 antibody validated for WB from a verified customer review.
Control Peptide
Hyaluronan Synthase 3/HAS3 Protein (NBP1-86328PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP1-86328 in the following applications:

Publications
Read Publications using
NBP1-86328 in the following applications:

Reactivity Notes

Rat reactivity reported in scientific literature (PMID: 28287145). Mouse reactivity reported from a verified customer review.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Hyaluronan Synthase 3/HAS3 Antibody

  • EC 2.4.1.212
  • HA synthase 3
  • HAS3
  • Hyaluronan Synthase 3
  • Hyaluronate synthase 3
  • Hyaluronic acid synthase 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-51635
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP2-37446
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP1-81637
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-81283
Species: Hu
Applications: IHC, IHC-P, WB
210-TA
Species: Hu
Applications: BA
NBP1-00201
Species: Hu
Applications: Flow, IF, IHC, PEP-ELISA
6507-IL/CF
Species: Hu
Applications: BA
DY413
Species: Mu
Applications: ELISA
236-EG
Species: Hu
Applications: BA
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-67360
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
233-FB/CF
Species: Hu
Applications: BA
NBP1-76538
Species: Hu, Mu, Po, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
AF3194
Species: Hu
Applications: ICC, Simple Western, WB
AF1034
Species: Mu, Rt
Applications: IHC, Simple Western, WB
285-IF
Species: Hu
Applications: BA
NBP1-86328
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Hyaluronan Synthase 3/HAS3 Antibody (NBP1-86328)(2)

We have publications tested in 2 confirmed species: Mouse, Rat.

We have publications tested in 2 applications: ICC/IF, IHC.


Filter By Application
ICC/IF
(1)
IHC
(1)
All Applications
Filter By Species
Mouse
(1)
Rat
(1)
All Species

Review for Hyaluronan Synthase 3/HAS3 Antibody (NBP1-86328) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.

Reviews using NBP1-86328:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot Hyaluronan Synthase 3/HAS3 NBP1-86328
Enlarge
5
reviewed by:
Kelly Steller
WB Mouse 03/09/2018
View

Summary

ApplicationWestern Blot
Sample TestedBrain and Lung,Mouse brain
SpeciesMouse
LotB113791

Comments

Comments1:1000 dilution


Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Hyaluronan Synthase 3/HAS3 Antibody (NBP1-86328) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Hyaluronan Synthase 3/HAS3 Products

Bioinformatics Tool for Hyaluronan Synthase 3/HAS3 Antibody (NBP1-86328)

Discover related pathways, diseases and genes to Hyaluronan Synthase 3/HAS3 Antibody (NBP1-86328). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Hyaluronan Synthase 3/HAS3 Antibody (NBP1-86328)

Discover more about diseases related to Hyaluronan Synthase 3/HAS3 Antibody (NBP1-86328).
 

Pathways for Hyaluronan Synthase 3/HAS3 Antibody (NBP1-86328)

View related products by pathway.

PTMs for Hyaluronan Synthase 3/HAS3 Antibody (NBP1-86328)

Learn more about PTMs related to Hyaluronan Synthase 3/HAS3 Antibody (NBP1-86328).

Blogs on Hyaluronan Synthase 3/HAS3

There are no specific blogs for Hyaluronan Synthase 3/HAS3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Kelly Steller
03/09/2018
Application: WB
Species: Mouse

Bioinformatics

Gene Symbol HAS3