Hyaluronan Synthase 3/HAS3 Antibody - BSA Free

Western Blot: Hyaluronan Synthase 3/HAS3 Antibody [NBP1-86328] - Lane 1: 50ug mouse whole lung lysate. Lane 2: 75ug mouse whole lung lysate. Lane 3: 50ug mouse brainstem lysate. Antibody at 1:1000. Image submitted by a verified customer review.

Immunohistochemistry-Paraffin: Hyaluronan Synthase 3/HAS3 Antibody [NBP1-86328] - Staining of human urinary bladder shows moderate to strong positivity in the extracellular matrix.

Immunohistochemistry-Paraffin: Hyaluronan Synthase 3/HAS3 Antibody [NBP1-86328] - Staining of human lung shows moderate positivity in respiratory epithelial cells.

Immunohistochemistry-Paraffin: Hyaluronan Synthase 3/HAS3 Antibody [NBP1-86328] - Staining of human prostate shows moderate to strong positivity in the extracellular matrix.

Immunohistochemistry-Paraffin: Hyaluronan Synthase 3/HAS3 Antibody [NBP1-86328] - Staining of human tonsil shows no positivity in lymphoid cells as expected.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Hyaluronan Synthase 3/HAS3 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RQEDAYMLDIFHEVLGGTEQAGFFVWRSNFHEAGEGETEASLQEGMDRVRDVVRASTFSC
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HAS3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence Reported in scientific literature (PMID 28287145)
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot Validated from a verified customer review
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Hyaluronan Synthase 3/HAS3 Protein (NBP1-86328PEP)

Reactivity Notes

Rat reactivity reported in scientific literature (PMID: 28287145). Mouse reactivity reported from a verified customer review.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Hyaluronan Synthase 3/HAS3 Antibody - BSA Free

• EC 2.4.1.212
• HA synthase 3
• HAS3
• Hyaluronan Synthase 3
• Hyaluronate synthase 3
• Hyaluronic acid synthase 3

Background

The protein encoded by the HAS3 gene is involved in the synthesis of the unbranched glycosaminoglycan hyaluronan, orhyaluronic acid, which is a major constituent of the extracellular matrix. This gene is a member of the NODC/HAS genefamily. Compared to the proteins encoded by other members of this gene family, this protein appears to be more of aregulator of hyaluronan synthesis. Two transcript variants encoding different isoforms have been found for this gene.(provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Hyaluronan Synthase 3/HAS3 Antibody (NBP1-86328)(3)

Publications using NBP1-86328

• Šínová R, Pavlík V, Šimek M et al. The hyaluronan metabolism in the UV-irradiated human epidermis and the relevance of in vitro epidermal models Experimental dermatology 2023-07-13 [PMID: 37443444]
• Mayer CA, Ganguly A, Mayer A Et al. CPAP-induced airway hyper-reactivity in mice is modulated by hyaluronan synthase-3 Pediatric research 2021-11-08 [PMID: 34750521] (IF/IHC, Mouse)
• Fowke TM, Karunasinghe RN, Bai JZ et al. Hyaluronan synthesis by developing cortical neurons in vitro. Sci Rep. 2017-03-13 [PMID: 28287145] (ICC/IF, Rat)

Review for Hyaluronan Synthase 3/HAS3 Antibody (NBP1-86328) (1)

Average Rating: 5

(Based on 1 review)

We have 1 review tested in 1 species: Mouse.

reviewed by: Verified Customer WB Mouse 03/09/2018

Summary

• Application: Western Blot
• Sample Tested: Brain and Lung,Mouse brain
• Species: Mouse
• Lot: B113791

Comments

• Comments: 1:1000 dilution

Bioinformatics

• Gene Symbol: HAS3