Recombinant Human HuC Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human HuC Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-367 of Human ELAVL3 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MVTQILGAMESQVGGGPAGPALPNGPLLGTNGATDDSKTNLIVNYLPQNMTQDEFKSLFGSIGDIESCKLVRDKITGQSLGYGFVNYSDPNDADKAIDTLNGLKLQTKTIKVSYARPSSASIRDANLYVSGLPRTMSQKEMEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFDKRIEAEEAIKGLNGQKPLGAAEPITVKFANNPSQKTGQALLTHLYQSSARRYAGPLHHQTQRFRLDNLLNMAYGVKSPLSLIARFSPIAIDGMSGLAGVGLSGGAAGAGWCIFVYNLSPEADESVLWQLFGPFGAVTNVKVIRDFTTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGERVLQVSFKTSKQHKA

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
ELAVL3

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human HuC Protein

  • DKFZp547J036
  • ELAV (embryonic lethal, abnormal vision, Drosophila)-like 3 (Hu antigen C)
  • ELAV-like protein 3
  • Hu antigen C
  • Hu-antigen C
  • HuC
  • HUCL
  • HUCParaneoplastic cerebellar degeneration-associated antigen
  • MGC20653
  • PLE21Paraneoplastic limbic encephalitis antigen 21

Background

ELAVL3( AAH14144, 1 a.a. - 368 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00001996-M01
Species: Hu, Rt
Applications: WB, ELISA, IHC-P, RNAi
NBP2-38012
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB110-58345
Species: Hu, Mu, Bv, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00001994-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-89917
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-58006
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-45825
Species: Hu
Applications: WB, IHC
MAB1259
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
NB300-143
Species: Hu, Mu, Rt, Po, Ca, Ch, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
H00001995-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for HuC Recombinant Protein (H00001995-P01) (0)

There are no publications for HuC Recombinant Protein (H00001995-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HuC Recombinant Protein (H00001995-P01) (0)

There are no reviews for HuC Recombinant Protein (H00001995-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HuC Recombinant Protein (H00001995-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HuC Products

Bioinformatics Tool for HuC Recombinant Protein (H00001995-P01)

Discover related pathways, diseases and genes to HuC Recombinant Protein (H00001995-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HuC Recombinant Protein (H00001995-P01)

Discover more about diseases related to HuC Recombinant Protein (H00001995-P01).
 

Pathways for HuC Recombinant Protein (H00001995-P01)

View related products by pathway.

PTMs for HuC Recombinant Protein (H00001995-P01)

Learn more about PTMs related to HuC Recombinant Protein (H00001995-P01).
 

Research Areas for HuC Recombinant Protein (H00001995-P01)

Find related products by research area.

Blogs on HuC

There are no specific blogs for HuC, but you can read our latest blog posts.

Customers Who Bought This Also Bought

HuC Antibody
NBP2-29864
GAP-43 Antibody
NB300-143

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human HuC Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ELAVL3