htrA4 Antibody

Images

 
Western Blot: HTRA4 Antibody [NBP1-69684] - This Anti-HTRA4 antibody was used in Western Blot of Fetal Brain tissue lysate at a concentration of 1ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

htrA4 Antibody Summary

Immunogen
Synthetic peptides corresponding to HTRA4(HtrA serine peptidase 4) The peptide sequence was selected from the middle region of HTRA4 (NP_710159). Peptide sequence LKMHYPDFPDVSSGVYVCKVVEGTAAQSSGLRDHDVIVNINGKPITTTTD.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HTRA4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Theoretical MW
51 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for htrA4 Antibody

  • EC 3.4.21
  • EC 3.4.21.-
  • EC 3.4.21.108
  • FLJ90724
  • HtrA serine peptidase 4
  • probable serine protease HTRA4

Background

HTRA4 is a member of the HtrA family of proteases. The protein contains a putative signal peptide, an insulin growth factor binding domain, a Kazal protease inhibitor domain, a conserved trypsin domain and a PDZ domain. Based on studies on other related family members, this enzyme may function as a secreted oligomeric chaperone protease to degrade misfolded secretory proteins. Other human HtrA proteins have been implicated in arthritis, tumor suppression, unfolded stress response, apoptosis, and aging.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-23869
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB, Simple Western, ICC/IF
AF1458
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NB600-1151
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
H00000726-P01
Species: Hu
AF1668
Species: Hu
Applications: WB, IP
AF8016
Species: Hu
Applications: WB, IHC
NBP1-89330
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NBP1-59744
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NB110-74730
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-62539
Species: Hu
Applications: WB
NBP1-91937
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-93579
Species: Hu
Applications: WB, B/N, IHC-Fr, IHC-P, In vitro
AF2487
Species: Hu
Applications: WB, IP
NB110-58849
Species: Hu, Mu, Rt, Po, Bv, Pm, Rb, Sh
Applications: WB, IB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00008521-M05
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P

Publications for htrA4 Antibody (NBP1-69684) (0)

There are no publications for htrA4 Antibody (NBP1-69684).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for htrA4 Antibody (NBP1-69684) (0)

There are no reviews for htrA4 Antibody (NBP1-69684). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for htrA4 Antibody (NBP1-69684) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional htrA4 Products

Bioinformatics Tool for htrA4 Antibody (NBP1-69684)

Discover related pathways, diseases and genes to htrA4 Antibody (NBP1-69684). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for htrA4 Antibody (NBP1-69684)

Discover more about diseases related to htrA4 Antibody (NBP1-69684).
 

Pathways for htrA4 Antibody (NBP1-69684)

View related products by pathway.

PTMs for htrA4 Antibody (NBP1-69684)

Learn more about PTMs related to htrA4 Antibody (NBP1-69684).

Blogs on htrA4

There are no specific blogs for htrA4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our htrA4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HTRA4
Entrez
Uniprot