htrA4 Antibody - BSA Free

Western Blot: htrA4 Antibody [NBP1-62690] - Human Brain lysate, concentration 0.2-1 ug/ml.

Product Discontinued

htrA4 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to HTRA4(HtrA serine peptidase 4) The peptide sequence was selected form the middle region of HTRA4. Peptide sequence LKMHYPDFPDVSSGVYVCKVVEGTAAQSSGLRDHDVIVNINGKPITTTTD. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HTRA4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for htrA4 Antibody - BSA Free

• EC 3.4.21
• EC 3.4.21.-
• EC 3.4.21.108
• FLJ90724
• HTRA 4
• HtrA serine peptidase 4
• HTRA4
• probable serine protease HTRA4

Background

HTRA4 is a member of the HtrA family of proteases. The protein contains a putative signal peptide, an insulin growth factor binding domain, a Kazal protease inhibitor domain, a conserved trypsin domain and a PDZ domain. Based on studies on other related family members, this enzyme may function as a secreted oligomeric chaperone protease to degrade misfolded secretory proteins. Other human HtrA proteins have been implicated in arthritis, tumor suppression, unfolded stress response, apoptosis, and aging.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HTRA4
• OMIM:
  • NP_710159(Human)
• Uniprot:
  • P83105(Human)