Home » HSP60 » HSP60 Proteins » HSP60 Recombinant Protein Antigen

HSP60 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for HSP60 Recombinant Protein Antigen (NBP2-55503PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

HSP60 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HSP60.

Source: E.coli

Amino Acid Sequence: KGVITVKDGKTLNDELEIIEGMKFDRGYISPYFINTSKGQKCEFQDAYVLLSEKKISSIQSIVPALEIANAHRKPLVIIAEDVDGEALSTLVLNRLKVGLQVVAVKAPGFGDNRKNQLKDMAIATGGAVFGEEGL
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
HSPD1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-55503 The protein was purified by IMAC chromatography and the expected concentration is greater than 0.5 mg/ml. This protein is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related information and a protocol, click here.
Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for HSP60 Recombinant Protein Antigen

  • 60 kDa chaperonin
  • Chaperonin 60
  • cpn60
  • GROEL
  • heat shock 60kD protein 1 (chaperonin)
  • heat shock 60kDa protein 1 (chaperonin)
  • Heat shock protein 60
  • heat shock protein 65
  • HLD4
  • HSP60
  • HSP-60
  • HSP60SPG13
  • HSP65
  • HSPD1
  • HuCHA60
  • Mitochondrial matrix protein P1,60 kDa heat shock protein, mitochondrial
  • P60 lymphocyte protein
  • short heat shock protein 60 Hsp60s1
  • spastic paraplegia 13 (autosomal dominant)
  • SPG13

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

HSP10/EPF Antibody
AF3298
Western blot shows lysates of Jurkat human acute T cell leukemia cell line, A431 human epithelial carcinoma cell line, and Neuro-2A mouse neuroblastoma cell line. PVDF membrane was probed with 1 µg/mL Human/Mouse HSP10/EPF Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3298) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band for HSP10/EPF was detected at approximately ??? kDa (as indicated). This experiment was conducted using Immunoblot Buffer Group 4.
(1 Publication)
Species: Hu, Mu
Applications: WB
HspA4 Antibody
(SD0861)
NBP2-67817
Western Blot: HspA4 Antibody (SD0861) [NBP2-67817] - Analysis of HSPA4 on Hela cells lysates using anti-HSPA4 antibody at 1/1,000 dilution.
Immunocytochemistry/Immunofluorescence: HspA4 Antibody (SD0861) [NBP2-67817] - Staining HSPA4 in HepG2 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: HspA4 Antibody (SD0861) [NBP2-67817] - Analysis of paraffin-embedded rat brain tissue using anti-HSPA4 antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
HSP90 alpha
Antibody
NBP1-77685
Western Blot: HSP90 alpha Antibody [NBP1-77685] - Analysis of HSP901a in 1: HeLa. 2: Ntera2. 3: A431. 4: HepG2. 5: MCF7. 6: NIH/3T3. 7: PC12. 8: COS7.
Immunocytochemistry/Immunofluorescence: HSP90 alpha Antibody [NBP1-77685] - HSP901a antibody was tested in MCF-7 cells with FITC (green). Nuclei and actin were counterstained with DAPI (blue) and Phalloidin (red).
Immunohistochemistry: HSP90 alpha Antibody [NBP1-77685] - Staining of human kidney carcinoma in HSP901A using DAB with hematoxylin counterstain.
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(32 Reviews)
(647 Publications)
Species: Hu
HSP27 Antibody
NBP1-75477
Knockout Validated: HSP27 Antibody [NBP1-75477] - Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and HSP27 knockout (KO) HeLa cell line. PVDF membrane was probed with 2 ug/ml of Rabbit Anti-Human HSP27 Polyclonal Antibody (Catalog # NBP1-75477) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (catalog number HAF008). Specific band was detected for HSP27 at approximately 27 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.
Western Blot: HSP27 Antibody [NBP1-75477] - Analysis of Jurkat cell lysate (30ug) using anti-Hsp27 antibody. Image from verified customer review.
Immunocytochemistry/Immunofluorescence: HSP27 Antibody [NBP1-75477] - Hsp27 Antibody [NBP1-75477] - HSP27 antibody was tested in HeLa cells with FITC (green). Nuclei and actin were counterstained with DAPI (blue) and Phalloidin (red).
(1 Review)
(2 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KO
IL-10 [Biotin]
DY417
(6 Reviews)
(186 Publications)
Species: Mu
IFN-gamma
[Unconjugated]
285-IF
Recombinant Human IFN-gamma (Catalog # 285‑IF) demonstrates anti-viral activity in HeLa human cervical epithelial carcinoma cells infected with encephalomyocarditis (EMC) virus. The activity is over 2-fold greater than the top competitor's IFN-gamma.
1 μg/lane of Recombinant Human IFN-gamma was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 17 kDa.
(19 Reviews)
(335 Publications)
Species: Hu
TLR4 Antibody
(76B357.1)
NB100-56566
Dual RNAscope ISH-IHC: TLR4 Antibody (76B357.1) [NB100-56566] - FFPE tissue sections of human tonsil were probed for TLR4 mRNA (ACD RNAScope Probe, ACD catalog # 311281; Fast Red chromogen, ACD catalog # 322750). Adjacent tissue section was processed for immunohistochemistry using Mouse Monoclonal (Novus Biologicals catalog # NB100-56566) at 5ug/mL with 1 hour incubation at room temperature followed by incubation with anti-mouse IgG VisUCyte HRP Polymer Antibody (Catalog # VC001) and DAB chromogen (yellow-brown). Tissue was counterstained with hematoxylin (blue). Specific staining was localized to lymphocytes.
Flow Cytometry: TLR4 Antibody (76B357.1) [NB100-56566] - Analysis using the Alexa Fluor (R) 647 conjugate of NBP2-27149. TLR4 expression on monocytes from human peripheral blood. PBMC were stained in a 2 color flow test, with CD14 PE version of this antibody and 1 ug of either isotype control (left) or TLR4-Alexa Fluor 647 (right). PPI negative, CD14+ cells were gated for analysis.
Immunohistochemistry: TLR4 Antibody (76B357.1) [NB100-56566] - Pericryptal Myofibroblasts are Responsible for Increased TLR4 Expression in a Subset of CRCs. Double-stained immunofluorescence for TLR4 (green) and vimentin (red) in normal (I), adenoma (II), and colon adenocarcinoma (III) (10x). In the stromal compartment of CRCs, immunofluorescent staining for TLR4 localized to the pericryptal myofibroblasts in a subset of samples. Image collected and cropped by CiteAb from the following publication (http://www.jeccr.com/content/33/1/45), licensed under a CC-BY licence.
(5 Reviews)
(101 Publications)
Species: Hu, Mu, Rt, Po, Bv, Ma
Applications: WB, ChIP, DB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, B/N, CyTOF-ready, Dual ISH-IHC, ELISA(Cap), Flow-CS, Flow-IC, KD, KO
IL-6 [HRP]
D6050
(25 Reviews)
(465 Publications)
Species: Hu
IL-4 [Unconjugated]
6507-IL/CF
IL-4 [Unconjugated]
(3 Publications)
Species: Hu
HSPA8/HSC71/Hsc70
Antibody (13D3)
NB120-2788
Western Blot: Hsp70 / Hsc70 Antibody (13D3) [NB120-2788] - Proteins were transferred to a PVDF membrane and blocked with 5% BSA/TBST for at least 1 hour. The membrane was probed with a HSP70 monoclonal antibody at a dilution of 1:1000 overnight at 4C on a rocking platform, washed in TBS-0.1%Tween 20, and probed with a goat anti-mouse IgM-HRP secondary antibody at a dilution of 1:20,000 for at least 1 hour.
Immunocytochemistry/Immunofluorescence: Hsp70 / Hsc70 Antibody (13D3) [NB120-2788] - Analysis of HSC70 using Monoclonal antibody (13D3) shows staining in NIH-3T3 cells. HSC70 staining (green), F-Actin staining with Phalloidin (red) and nuclei with DAPI (blue) is shown. Cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with or an antibody recognizing HSC70 at a dilution of 1:20-1:200 over night at 4C, washed with PBS and incubated with a DyLight-488 conjugated.
Immunohistochemistry-Paraffin: Hsp70 / Hsc70 Antibody (13D3) [NB120-2788] - Both normal and cancer biopsies of deparaffinized human Prostate carcinoma tissue.
(2 Reviews)
(18 Publications)
Species: Hu, Mu, Rt, Bv, Fe, Fi, Ha, Pm
Applications: WB, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N
DNAJB6 Antibody
(2C11-C1)
H00010049-M01
Western Blot: DNAJB6 Antibody (2C11-C1) [H00010049-M01] - DNAJB6 monoclonal antibody (M01), clone 2C11-C1 Analysis of DNAJB6 expression in Jurkat.
Western Blot: DNAJB6 Antibody (2C11-C1) [H00010049-M01] - DNAJB6 monoclonal antibody (M01), clone 2C11-C1. Analysis of DNAJB6 expression in C32.
Western Blot: DNAJB6 Antibody (2C11-C1) [H00010049-M01] - Analysis of DNAJB6 expression in transfected 293T cell line by DNAJB6 monoclonal antibody (M01), clone 2C11-C1.Lane 1: DNAJB6 transfected lysate(27 KDa).Lane 2: Non-transfected lysate.
(7 Publications)
Species: Hu
Applications: ICC/IF (-), WB, ELISA
DNAJA2 Antibody
(OTI3A10)
NBP2-02996
Western Blot: DNAJA2 Antibody (3A10) [NBP2-02996] Analysis of extracts (35ug) from 9 different cell lines by using anti-DNAJA2 monoclonal antibody.
Immunocytochemistry/Immunofluorescence: DNAJA2 Antibody (3A10) [NBP2-02996] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY DNAJA2.
Immunohistochemistry-Paraffin: DNAJA2 Antibody (3A10) [NBP2-02996] - Staining of paraffin-embedded Human thyroid tissue using anti-DNAJA2 mouse monoclonal antibody.
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
IL-2 [Unconjugated]
202-IL
1 μg/lane of Recombinant Human IL-2 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 13 kDa.
Recombinant Human IL-2 (Catalog # 202-IL) stimulates cell proliferation of the CTLL‑2 mouse cytotoxic T cell line. The ED50 for this effect is 0.05-0.25 ng/mL.
(22 Reviews)
(302 Publications)
Species: Hu
TST Antibody
NBP1-87148
Western Blot: TST Antibody [NBP1-87148] - Analysis in human liver tissue.
Immunohistochemistry-Paraffin: TST Antibody [NBP1-87148] - Staining of human kidney.
Immunohistochemistry-Paraffin: TST Antibody [NBP1-87148] - Staining of human colon shows high expression.
(1 Publication)
Species: Hu
Applications: WB, IHC, IHC-P
NOV/CCN3 Antibody
AF1640
NOV/CCN3 was detected in immersion fixed paraffin-embedded sections of human renal cancer tissue using Goat Anti-Human NOV/CCN3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1640) at 1.7 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific labeling was localized to the cytoplasm of epithelial cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(3 Publications)
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), ELISA(Sta)
Plexin A1 Antibody
[Unconjugated]
AF4309
Western blot shows lysates of mouse embryonic heart tissue. PVDF Membrane was probed with 1 µg/mL of Mouse Plexin A1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4309) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for Plexin A1 at approximately 200 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
Plexin A1 was detected in immersion fixed frozen sections of embryonic mouse spinal cord using Mouse Plexin A1 Affinity-purified Polyclonal Antibody (Catalog # AF4309) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
Plexin A1 was detected in immersion fixed immature human dendritic cells using Goat Anti-Mouse Plexin A1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4309) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to cell surfaces and cytoplasm. View our protocol for Fluorescent ICC Staining of Non-adherent Cells.
(1 Publication)
Species: Hu, Mu
Applications: WB, IHC, ICC
HSP60 Recombinant
Protein Antigen
NBP2-55503PEP
HSP60 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for HSP60 Recombinant Protein Antigen (NBP2-55503PEP) (0)

There are no publications for HSP60 Recombinant Protein Antigen (NBP2-55503PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HSP60 Recombinant Protein Antigen (NBP2-55503PEP) (0)

There are no reviews for HSP60 Recombinant Protein Antigen (NBP2-55503PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for HSP60 Recombinant Protein Antigen (NBP2-55503PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Learn about Custom Antibody Labeling

Additional HSP60 Products

Bioinformatics Tool for HSP60 Recombinant Protein Antigen (NBP2-55503PEP)

Discover related pathways, diseases and genes to HSP60 Recombinant Protein Antigen (NBP2-55503PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HSP60 Recombinant Protein Antigen (NBP2-55503PEP)

Discover more about diseases related to HSP60 Recombinant Protein Antigen (NBP2-55503PEP).
 

Pathways for HSP60 Recombinant Protein Antigen (NBP2-55503PEP)

View related products by pathway.

PTMs for HSP60 Recombinant Protein Antigen (NBP2-55503PEP)

Learn more about PTMs related to HSP60 Recombinant Protein Antigen (NBP2-55503PEP).
 

Research Areas for HSP60 Recombinant Protein Antigen (NBP2-55503PEP)

Find related products by research area.

Blogs on HSP60.

Check out the latest blog posts on HSP60.
TLR4 - A Guardian of Innate Immunity
Toll-like receptor 4 (TLR4) belongs to the family of Toll-like receptors (TLR), and plays a main role in pathogen recognition and innate immunity system activation. The TLR family members are highly conserved proteins that all contain a high degree of...  Read full blog post.
Customer Experience using HSP60 Antibody
I began using the HSP60 antibody (NB110-57063) in June of 2010 and it worked well. I do not like to buy antibodies that have not been tested in the species for which I will use them, so I picked this antibody because it had already been tested in rat...  Read full blog post.
Heat Shock Proteins: An Overview
Heat Shock Proteins (HSPs) are a ubiquitous group of molecular chaperone proteins that have evolved unique mechanisms, within their host cells, to facilitate survival in hostile environments such as heat, oxidative (hypoxia), pH and cold. Under permis...  Read full blog post.
The Heat is On: Heat Shock Proteins and the Link to Cancer
Novus Biologicals offers an extensive antibody catalog targeting heat shock proteins (HSPs). A large protein group covering a number of families, the HSPs are functionally related by their dramatic upregulation in response to stress. Stress triggers m...  Read full blog post.

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
Western Blot: HSP60 Antibody [NBP1-77397] - Analysis of extracts from HeLa and COS cells using NBP1-77397 Hsp60 antibody at 1:1000
HSP60 Antibody
NBP1-77397

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our HSP60 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol HSPD1