HSP60 Recombinant Protein Antigen

Images

 
There are currently no images for HSP60 Recombinant Protein Antigen (NBP2-55503PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

HSP60 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HSP60.

Source: E.coli

Amino Acid Sequence: KGVITVKDGKTLNDELEIIEGMKFDRGYISPYFINTSKGQKCEFQDAYVLLSEKKISSIQSIVPALEIANAHRKPLVIIAEDVDGEALSTLVLNRLKVGLQVVAVKAPGFGDNRKNQLKDMAIATGGAVFGEEGL

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
HSPD1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-55503 The protein was purified by IMAC chromatography and the expected concentration is greater than 0.5 mg/ml. This protein is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related information and a protocol, click here.
Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for HSP60 Recombinant Protein Antigen

  • 60 kDa chaperonin
  • Chaperonin 60
  • cpn60
  • GROEL
  • heat shock 60kD protein 1 (chaperonin)
  • heat shock 60kDa protein 1 (chaperonin)
  • Heat shock protein 60
  • heat shock protein 65
  • HLD4
  • HSP60
  • HSP-60
  • HSP60SPG13
  • HSP65
  • HSPD1
  • HuCHA60
  • Mitochondrial matrix protein P1,60 kDa heat shock protein, mitochondrial
  • P60 lymphocyte protein
  • short heat shock protein 60 Hsp60s1
  • spastic paraplegia 13 (autosomal dominant)
  • SPG13

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3298
Species: Hu, Mu
Applications: WB
NBP2-67817
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-77685
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-75477
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KO
NB100-56566
Species: Hu, Mu, Rt, Po, Bv, Ma
Applications: WB, ChIP, DB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, B/N, CyTOF-ready, Dual ISH-IHC, ELISA(Cap), Flow-CS, Flow-IC, KD, KO
NB120-2788
Species: Hu, Mu, Rt, Bv, Fe, Fi, Ha, Pm
Applications: WB, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N
H00010049-M01
Species: Hu
Applications: ICC/IF (-), WB, ELISA
NBP2-02996
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-87148
Species: Hu
Applications: WB, IHC, IHC-P
AF1640
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), ELISA(Sta)
AF4309
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP2-55503PEP
Species: Hu
Applications: AC

Publications for HSP60 Recombinant Protein Antigen (NBP2-55503PEP) (0)

There are no publications for HSP60 Recombinant Protein Antigen (NBP2-55503PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HSP60 Recombinant Protein Antigen (NBP2-55503PEP) (0)

There are no reviews for HSP60 Recombinant Protein Antigen (NBP2-55503PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for HSP60 Recombinant Protein Antigen (NBP2-55503PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional HSP60 Products

Bioinformatics Tool for HSP60 Recombinant Protein Antigen (NBP2-55503PEP)

Discover related pathways, diseases and genes to HSP60 Recombinant Protein Antigen (NBP2-55503PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HSP60 Recombinant Protein Antigen (NBP2-55503PEP)

Discover more about diseases related to HSP60 Recombinant Protein Antigen (NBP2-55503PEP).
 

Pathways for HSP60 Recombinant Protein Antigen (NBP2-55503PEP)

View related products by pathway.

PTMs for HSP60 Recombinant Protein Antigen (NBP2-55503PEP)

Learn more about PTMs related to HSP60 Recombinant Protein Antigen (NBP2-55503PEP).
 

Research Areas for HSP60 Recombinant Protein Antigen (NBP2-55503PEP)

Find related products by research area.

Blogs on HSP60.

TLR4 - A Guardian of Innate Immunity
Toll-like receptor 4 (TLR4) belongs to the family of Toll-like receptors (TLR), and plays a main role in pathogen recognition and innate immunity system activation. The TLR family members are highly conserved proteins that all contain a high degree of...  Read full blog post.

Customer Experience using HSP60 Antibody
I began using the HSP60 antibody (NB110-57063) in June of 2010 and it worked well. I do not like to buy antibodies that have not been tested in the species for which I will use them, so I picked this antibody because it had already been tested in rat...  Read full blog post.

Heat Shock Proteins: An Overview
Heat Shock Proteins (HSPs) are a ubiquitous group of molecular chaperone proteins that have evolved unique mechanisms, within their host cells, to facilitate survival in hostile environments such as heat, oxidative (hypoxia), pH and cold. Under permis...  Read full blog post.

The Heat is On: Heat Shock Proteins and the Link to Cancer
Novus Biologicals offers an extensive antibody catalog targeting heat shock proteins (HSPs). A large protein group covering a number of families, the HSPs are functionally related by their dramatic upregulation in response to stress. Stress triggers m...  Read full blog post.

Customers Who Bought This Also Bought

HSP60 Antibody
NBP1-77397

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our HSP60 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol HSPD1