HSD3B7 Recombinant Protein Antigen

Images

 
There are currently no images for HSD3B7 Recombinant Protein Antigen (NBP2-56368PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

HSD3B7 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HSD3B7.

Source: E. coli

Amino Acid Sequence: LVLYAPLLNPYTLAVANTTFTVSTDKAQRHFGYEPLFSWEDSRTRTILWVQAATGSAQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
HSD3B7
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56368.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for HSD3B7 Recombinant Protein Antigen

  • 3 beta-hydroxy-delta 5-C27-steroid oxidoreductase
  • 3 beta-hydroxysteroid dehydrogenase type 7
  • 3 beta-hydroxysteroid dehydrogenase type VII
  • 3-beta-HSD VII
  • 7-alpha-diol 3-beta-dehydrogenase
  • C(27) 3-beta-HSD
  • C(27)-3BETA-HSD
  • Cholest-5-ene-3-beta
  • EC 1.1.1.-
  • EC 1.1.1.181
  • hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 7,3-beta-hydroxy-Delta(5)-C27 steroid oxidoreductase
  • PFIC4
  • SDR11E3
  • short chain dehydrogenase/reductase family 11E, member 3

Background

HSD3B7 codes for a protein with a length of 369 amino acids and a weight of approximately 41 kDa, with a shorter isoform with a length of 196 amino acids and a weight of approximately 21 kDa, and is a protein that plays a role in the biosynthesis of all classes of hormonal steroids, as it does not metabolize several different C steroids as substrates. It is also involved in bile acid synthesis from cholesterol. Current studies are being done on diseases and disorders relating to this gene including congenital bile acid synthesis defect, hepatitis, jaundice, cholesterol, tuberculosis, and neuronitis. HSD3B7 has also been shown to have interactions with PLSCR1, AKR1D1, CYP27A1, CYP39A1, and CYP7A1 in pathways such as the bile acid biosynthesis and metabolic pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-78644
Species: Pm, Bv, Gt, Hu, Mu, Po, Pm, Rt, Sh
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-27352
Species: Hu, Pm, Pm
Applications: IHC,  IHC-P, WB
PP-A9033A-00
Species: Hu
Applications: DirELISA, IHC, IP, WB
NBP1-32353
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-93736
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-38770
Species: Hu, Mu
Applications:  IHC-P, WB
AF5510
Species: Hu
Applications: WB
DVE00
Species: Hu
Applications: ELISA
NBP1-86182
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-44245
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
302-B2
Species: Hu
Applications: BA
NB300-221
Species: Av, Bv, Ca, Ch, ChHa, Dr, Eq, Fe, Ha, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, Sh, Ze
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Simple Western, Single-Cell Western, WB
NBP1-87094
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-83210
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
DPI00
Species: Hu
Applications: ELISA
NBP1-51843
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
AF1705
Species: Mu
Applications: IHC, WB
MAB1980
Species: Hu
Applications: ICC, IP, Simple Western, WB
NBP1-51911
Species: Hu, Mu
Applications: ChIP, IHC,  IHC-P, PEP-ELISA, WB
AF1759
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB

Publications for HSD3B7 Recombinant Protein Antigen (NBP2-56368PEP) (0)

There are no publications for HSD3B7 Recombinant Protein Antigen (NBP2-56368PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HSD3B7 Recombinant Protein Antigen (NBP2-56368PEP) (0)

There are no reviews for HSD3B7 Recombinant Protein Antigen (NBP2-56368PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for HSD3B7 Recombinant Protein Antigen (NBP2-56368PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HSD3B7 Products

Blogs on HSD3B7

There are no specific blogs for HSD3B7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our HSD3B7 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol HSD3B7