HSD3B7 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

HSD3B7 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HSD3B7.
  
  

  Source: E. coli

  Amino Acid Sequence: VVRMLLQREPRLGELRVFDQHLGPWLEELKTGPVRVTAIQGDVTQAHEVAAAVAGAHVVIHTAGLVDVFGRASPKTIHEVNVQG

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: HSD3B7
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-14103.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 27 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for HSD3B7 Recombinant Protein Antigen

• 3 beta-hydroxy-delta 5-C27-steroid oxidoreductase
• 3 beta-hydroxysteroid dehydrogenase type 7
• 3 beta-hydroxysteroid dehydrogenase type VII
• 3-beta-HSD VII
• 7-alpha-diol 3-beta-dehydrogenase
• C(27) 3-beta-HSD
• C(27)-3BETA-HSD
• Cholest-5-ene-3-beta
• EC 1.1.1.-
• EC 1.1.1.181
• hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 7,3-beta-hydroxy-Delta(5)-C27 steroid oxidoreductase
• PFIC4
• SDR11E3
• short chain dehydrogenase/reductase family 11E, member 3

Background

HSD3B7 codes for a protein with a length of 369 amino acids and a weight of approximately 41 kDa, with a shorter isoform with a length of 196 amino acids and a weight of approximately 21 kDa, and is a protein that plays a role in the biosynthesis of all classes of hormonal steroids, as it does not metabolize several different C steroids as substrates. It is also involved in bile acid synthesis from cholesterol. Current studies are being done on diseases and disorders relating to this gene including congenital bile acid synthesis defect, hepatitis, jaundice, cholesterol, tuberculosis, and neuronitis. HSD3B7 has also been shown to have interactions with PLSCR1, AKR1D1, CYP27A1, CYP39A1, and CYP7A1 in pathways such as the bile acid biosynthesis and metabolic pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: HSD3B7