Home » Hsd3b5 » Hsd3b5 Antibodies » Hsd3b5 Antibody - BSA Free

We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Register on R&D Systems

Hsd3b5 Antibody - BSA Free

 Submit a Review

Images

 
(
Enlarge)
Western Blot: Hsd3b5 Antibody [NBP3-10145] - Western blot analysis of Hsd3b5 in Mouse Testis lysates. Antibody dilution at 1ug/ml
Western Blot: Hsd3b5 Antibody [NBP3-10145] - Western blot analysis of Hsd3b5 in Mouse Testis lysates. Antibody dilution at 1ug/ml

Product Details

Summary
Product Discontinued
View other related Hsd3b5 Primary Antibodies

Order Details


    • Catalog Number
      NBP3-10145
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Hsd3b5 Antibody - BSA Free Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle terminal region of mouse Hsd3b5 (NP_032321.2). Peptide sequence PKKSPSIQGQFYYISDNTPHQSYDDLNYTLSKEWGLCLDSGWSLPLSLLY
Clonality
Polyclonal
Host
Rabbit
Gene
Hsd3b5
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
42 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for Hsd3b5 Antibody - BSA Free

  • 3(beta)H

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Beta
Hydroxysteroid Dehydr ...
NBP1-32353
Immunohistochemistry-Paraffin Beta Hydroxysteroid Dehydrogenase Antibody - BSA Free
Western Blot Beta Hydroxysteroid Dehydrogenase Antibody - BSA Free
(1 Review)
(1 Publication)
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
POMC Antibody
NB100-1533
Flow Cytometry POMC Antibody
Immunohistochemistry POMC Antibody
Immunohistochemistry POMC Antibody
(11 Publications)
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
CYP11A1 Antibody -
Azide and BSA Free
NBP2-92879
Immunohistochemistry-Paraffin CYP11A1 Antibody - Azide and BSA Free
Western Blot CYP11A1 Antibody - Azide and BSA Free
Western Blot CYP11A1 Antibody - Azide and BSA Free
(1 Review)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
HSD3B1 Antibody
(FDO66Q) - BSA Free
NB110-78644
Immunohistochemistry HSD3B1 Antibody (FDO66Q) - BSA Free
(12 Publications)
Species: Pm, Bv, Gt, Hu, Mu, Po, Pm, Rt, Sh
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
Cytochrome P450
17A1 Antibody (OTI3F1
NBP2-01151
Immunohistochemistry Cytochrome P450 17A1 Antibody (OTI3F11)
Immunohistochemistry Cytochrome P450 17A1 Antibody (OTI3F11)
Flow Cytometry Cytochrome P450 17A1 Antibody (OTI3F11)
(2 Reviews)
(6 Publications)
Species: Hu
Applications: Flow, IHC,  IHC-P, WB
Carbohydrate
Sulfotransferase 3/CH ...
MAB7450
Immunohistochemistry Carbohydrate Sulfotransferase 3/CHST3 Antibody (799011)
Species: Hu
Applications: IHC

SF-1/NR5A1/Steroidogen ...
NBP2-88921
Immunocytochemistry/ Immunofluorescence SF-1/NR5A1/Steroidogenic Factor 1 Antibody (CL9101) - BSA Free
Immunohistochemistry-Paraffin SF-1/NR5A1/Steroidogenic Factor 1 Antibody (CL9101) - BSA Free
Immunohistochemistry-Paraffin SF-1/NR5A1/Steroidogenic Factor 1 Antibody (CL9101) - BSA Free
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
StAR Antibody
NBP1-33485
Western Blot StAR Antibody
Western Blot StAR Antibody
Immunohistochemistry-Paraffin StAR Antibody
(5 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
CYP21A2 Antibody -
BSA Free
NBP2-13893
Immunohistochemistry-Paraffin CYP21A2 Antibody - BSA Free
Immunohistochemistry-Paraffin CYP21A2 Antibody - BSA Free
Immunohistochemistry-Paraffin CYP21A2 Antibody - BSA Free
Species: Hu
Applications: IHC,  IHC-P, WB
Aromatase Antibody
- BSA Free
NB100-1596
Western Blot Aromatase Antibody - BSA Free
Western Blot Aromatase Antibody - BSA Free
Immunohistochemistry-Paraffin Aromatase Antibody - BSA Free
(16 Publications)
Species: Hu, Mu, Pm, Rb, Rt
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
PLOD1 Antibody -
BSA Free
NBP2-38770
Western Blot PLOD1 Antibody - BSA Free
Western Blot PLOD1 Antibody - BSA Free
(3 Publications)
Species: Hu
Applications: WB
Prolactin Antibody
[Unconjugated]
AF1445
Neutralization Prolactin Antibody [Unconjugated]
Western Blot Prolactin Antibody [Unconjugated]
Immunohistochemistry Prolactin Antibody [Unconjugated]
(8 Publications)
Species: Mu, Rt
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, Simple Western, WB
BRD2 Antibody
NBP1-30475
Immunoprecipitation BRD2 Antibody
Western Blot BRD2 Antibody
Western Blot BRD2 Antibody
(1 Review)
(3 Publications)
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
Cytochrome b5 type
A Antibody - BSA Free ...
NBP2-49284
Immunocytochemistry/ Immunofluorescence Cytochrome b5 type A Antibody - BSA Free
Immunohistochemistry-Paraffin Cytochrome b5 type A Antibody - BSA Free
Immunohistochemistry-Paraffin Cytochrome b5 type A Antibody - BSA Free
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
Androgen R/NR3C4
[p Ser213, p Ser210] ...
NB100-56603
Western Blot Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) - BSA Free
(14 Publications)
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC,  IHC-P, WB
CYP11B1 Antibody -
BSA Free
NBP2-49223
Immunohistochemistry-Paraffin CYP11B1 Antibody - BSA Free
Immunohistochemistry-Paraffin CYP11B1 Antibody - BSA Free
Immunohistochemistry-Paraffin CYP11B1 Antibody - BSA Free
Species: Hu
Applications: IHC,  IHC-P
CYP11B2 Antibody -
BSA Free
NBP2-13891
Immunohistochemistry-Paraffin CYP11B2 Antibody - BSA Free
Immunohistochemistry-Paraffin CYP11B2 Antibody - BSA Free
Immunohistochemistry-Paraffin CYP11B2 Antibody - BSA Free
(3 Publications)
Species: Hu
Applications: IHC,  IHC-P
Cytosolic
Sulfotransferase 2A1/ ...
AF5828
Immunocytochemistry Cytosolic Sulfotransferase 2A1/SULT2A1 Antibody
Western Blot Cytosolic Sulfotransferase 2A1/SULT2A1 Antibody
Species: Hu
Applications: ICC, Neut, WB

Publications for Hsd3b5 Antibody (NBP3-10145) (0)

There are no publications for Hsd3b5 Antibody (NBP3-10145).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Hsd3b5 Antibody (NBP3-10145) (0)

There are no reviews for Hsd3b5 Antibody (NBP3-10145). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Hsd3b5 Antibody (NBP3-10145) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Blogs on Hsd3b5

There are no specific blogs for Hsd3b5, but you can read our latest blog posts.

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Hsd3b5 Antibody - BSA Free and receive a gift card or discount.


Bioinformatics

Gene Symbol Hsd3b5