HSD17B8 Antibody - BSA Free

Western Blot: HSD17B8 Antibody [NBP3-35292] - Western blot analysis of various lysates using HSD17B8 Rabbit pAb at 1:3000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.

Immunocytochemistry/ Immunofluorescence: HSD17B8 Antibody [NBP3-35292] - Immunofluorescence analysis of U-2 OS cells using HSD17B8 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

HSD17B8 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit HSD17B8 Antibody - BSA Free (NBP3-35292) is a polyclonal antibody validated for use in WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-261 of human HSD17B8 (NP_055049.1).
  
  Sequence:
  MASQLQNRLRSALALVTGAGSGIGRAVSVRLAGEGATVAACDLDRAAAQETVRLLGGPGSKEGPPRGNHAAFQADVSEARAARCLLEQVQACFSRPPSVVVSCAGITQDEFLLHMSEDDWDKVIAVNLKGTFLVTQAAAQALVSNGCRGSIINISSIVGKVGNVGQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMTQKVPQKVVDKITEMIPMGHLGDPEDVADVVAFLASEDSGYITGTSVEVTGGLFM
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HSD17B8
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:100
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 27 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for HSD17B8 Antibody - BSA Free

• D6S2245EdJ1033B10.9
• EC 1.1.1.-
• EC 1.1.1.62
• EC 1.1.1.63,17-beta-HSD 8
• estrogen 17-oxidoreductase
• FABGLestradiol 17-beta-dehydrogenase 8
• H2-KE6
• HKE6FabG (beta-ketoacyl-[acyl-carrier-protein] reductase, E coli) like (E. coli)
• hydroxysteroid (17-beta) dehydrogenase 8,3-oxoacyl-[acyl-carrier-protein] reductase
• KE6
• ke-6
• Ke-6,17-beta-hydroxysteroid dehydrogenase 8
• Protein Ke6
• Really interesting new gene 2 protein
• RING2FABG
• SDR30C1
• short chain dehydrogenase/reductase family 30C, member 1
• Testosterone 17-beta-dehydrogenase 8

Background

In mice, the Ke6 protein is a 17-beta-hydroxysteroid dehydrogenase that can regulate the concentration of biologically active estrogens and androgens. It is preferentially an oxidative enzyme and inactivates estradiol, testosterone, and dihydrotestosterone. However, the enzyme has some reductive activity and can synthesize estradiol from estrone. The protein encoded by this gene is similar to Ke6 and is a member of the short-chain dehydrogenase superfamily. An alternatively spliced transcript of this gene has been detected, but the full-length nature of this variant has not been determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HSD17B8