Recombinant Human HSD17B7 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human HSD17B7 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 255-341 of Human HSD17B7

Source: Wheat Germ

Amino Acid Sequence: NAFTLTPYNGTEALVWLFHQKPESLNPLIKYLSATTGFGRNYIMTQKMDLDEDTAEKFYQKLLELEKHIRVTIQKTDNQARLSGSCL

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
HSD17B7
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
35.31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human HSD17B7 Protein

  • 17 beta-hydroxysteroid dehydrogenase type VII
  • 17-beta-hydroxysteroid dehydrogenase 7
  • 3-keto-steroid reductase
  • EC 1.1.1.270
  • EC 1.1.1.62
  • Estradiol 17-beta-dehydrogenase 7
  • hydroxysteroid (17-beta) dehydrogenase 7,17beta hydroxysteroid dehydrogenase
  • MGC12523
  • MGC75018,17-beta-HSD 7
  • PRAP
  • SDR37C1
  • short chain dehydrogenase/reductase family 37C, member 1

Background

The 17-beta-hydroxysteroid dehydrogenase enzyme (EC 1.1.1.62) oxidizes or reduces estrogens and androgens in mammals and regulates the biologic potency of these steroids.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89388
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1596
Species: Hu, Pm, Rb
Applications: WB, ICC/IF, IHC
NBP1-84901
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB300-560
Species: Hu, Mu, Rt, Av, Bv, Pm
Applications: WB, IHC, IHC-Fr, IHC-P, IF
NBP2-02142
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-92011
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-54758
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-33485
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-561
Species: Hu, Mu, Rt, Po, Bv, Eq, Ha, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ICC, IF
NB200-305
Species: Hu, Mu, Mk, Rb
Applications: WB, ChIP, DB, Flow, ICC/IF, IHC, IHC-P, IP
H00005087-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
AF5415
Species: Hu
Applications: WB, IHC, ICC
MAB6799
Species: Hu
Applications: WB, IHC
NBP2-20460
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, ChIP

Publications for HSD17B7 Partial Recombinant Protein (H00051478-Q01) (0)

There are no publications for HSD17B7 Partial Recombinant Protein (H00051478-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HSD17B7 Partial Recombinant Protein (H00051478-Q01) (0)

There are no reviews for HSD17B7 Partial Recombinant Protein (H00051478-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HSD17B7 Partial Recombinant Protein (H00051478-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for HSD17B7 Partial Recombinant Protein (H00051478-Q01)

Discover related pathways, diseases and genes to HSD17B7 Partial Recombinant Protein (H00051478-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HSD17B7 Partial Recombinant Protein (H00051478-Q01)

Discover more about diseases related to HSD17B7 Partial Recombinant Protein (H00051478-Q01).
 

Pathways for HSD17B7 Partial Recombinant Protein (H00051478-Q01)

View related products by pathway.

PTMs for HSD17B7 Partial Recombinant Protein (H00051478-Q01)

Learn more about PTMs related to HSD17B7 Partial Recombinant Protein (H00051478-Q01).

Blogs on HSD17B7

There are no specific blogs for HSD17B7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

HSD17B7 Antibody
NBP2-14102

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human HSD17B7 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol HSD17B7