HPRT Antibody (4C3-G8)

Images

 
Western Blot: HPRT Antibody (4C3-G8) [H00003251-M01] - HPRT1 monoclonal antibody (M01), clone 4C3-G8 Analysis of HPRT1 expression in MCF-7.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
4C3-G8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

HPRT Antibody (4C3-G8) Summary

Immunogen
HPRT1 (AAH00578, 1 a.a. - 218 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MATRSPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA
Specificity
HPRT1 - hypoxanthine phosphoribosyltransferase 1 (Lesch-Nyhan syndrome)
Isotype
IgG
Clonality
Monoclonal
Host
Mouse
Gene
HPRT1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.
Publications
Read Publication using H00003251-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HPRT Antibody (4C3-G8)

  • EC 2.4.2.8
  • HGPRTHPRTHGPRTase
  • hypoxanthine phosphoribosyltransferase 1
  • hypoxanthine-guanine phosphoribosyltransferase

Background

HPRT1 has a central role in the generation of purine nucleotides through the purine salvage pathway. HPRT1 catalyzes conversion of hypoxanthine to inosine monophosphate and guanine to guanosine monophosphate via transfer of the 5-phosphoribosyl group from 5-phosphoribosyl 1-pyrophosphate (Keebaugh et al., 2007 [PubMed 16928426]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89519
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IP
NB100-236
Species: Hu, Mu
Applications: WB, IB, IHC, IHC-Fr, IHC-P, IP
AF6486
Species: Hu
Applications: WB, Simple Western
NBP1-91705
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83107
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87404
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-84956
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-87441
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-64792
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr
NB600-501
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, Fi, GP, Ha, Le, Ma, Pm, Rb, Sh, Sq, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB600-935
Species: Bv
Applications: WB, ELISA, IP
NB500-317
Species: Hu, Bv(-), Ca(-), Ch(-), Mu(-), Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, RIA
NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-15291
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for HPRT Antibody (H00003251-M01)(1)

Reviews for HPRT Antibody (H00003251-M01) (0)

There are no reviews for HPRT Antibody (H00003251-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HPRT Antibody (H00003251-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HPRT Products

Bioinformatics Tool for HPRT Antibody (H00003251-M01)

Discover related pathways, diseases and genes to HPRT Antibody (H00003251-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HPRT Antibody (H00003251-M01)

Discover more about diseases related to HPRT Antibody (H00003251-M01).
 

Pathways for HPRT Antibody (H00003251-M01)

View related products by pathway.

PTMs for HPRT Antibody (H00003251-M01)

Learn more about PTMs related to HPRT Antibody (H00003251-M01).
 

Research Areas for HPRT Antibody (H00003251-M01)

Find related products by research area.

Blogs on HPRT

There are no specific blogs for HPRT, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HPRT Antibody (4C3-G8) and receive a gift card or discount.

Bioinformatics

Gene Symbol HPRT1
Entrez
OMIM
Uniprot