HP1 alpha Antibody (8C3M6)

Western Blot: HP1 alpha Antibody (8C3M6) [NBP3-16267] - Western blot analysis of extracts of various cell lines, using HP1 alphaRabbit mAb (NBP3-16267) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.

Western Blot: HP1 alpha Antibody (8C3M6) [NBP3-16267] - Western blot analysis of extracts of various cell lines, using HP1 alphaRabbit mAb (NBP3-16267) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

Immunoprecipitation: HP1 alpha Antibody (8C3M6) [NBP3-16267] - Immunoprecipitation analysis of 300ug extracts of MCF7 cells using 3ug HP1 alpha antibody (NBP3-16267). Western blot was performed from the immunoprecipitate using HP1 alpha antibody (NBP3-16267) at a dilition of 1:1000.

Immunohistochemistry: HP1 alpha Antibody (8C3M6) [NBP3-16267] - Immunohistochemistry analysis of paraffin-embedded Mouse brain tissue using HP1 alpha Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry: HP1 alpha Antibody (8C3M6) [NBP3-16267] - Immunohistochemistry analysis of paraffin-embedded Rat brain tissue using HP1 alpha Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry: HP1 alpha Antibody (8C3M6) [NBP3-16267] - Immunohistochemistry analysis of paraffin-embedded Human lung cancer tissue using HP1 alpha Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry: HP1 alpha Antibody (8C3M6) [NBP3-16267] - Immunohistochemistry analysis of paraffin-embedded Mouse kidney tissue using HP1 alpha Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry: HP1 alpha Antibody (8C3M6) [NBP3-16267] - Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using HP1 alpha Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry: HP1 alpha Antibody (8C3M6) [NBP3-16267] - Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using HP1 alpha Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunocytochemistry/ Immunofluorescence: HP1 alpha Antibody (8C3M6) [NBP3-16267] - Confocal imaging of C6 cells using HP1 alpha Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L).The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo(R) 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green).DAPI was used for nuclear staining (Blue). Objective: 100x.

Immunohistochemistry: HP1 alpha Antibody (8C3M6) [NBP3-16267] - Immunohistochemistry analysis of paraffin-embedded Human thyroid cancer tissue using HP1 alpha Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry: HP1 alpha Antibody (8C3M6) [NBP3-16267] - Immunohistochemistry analysis of paraffin-embedded Mouse lung tissue using HP1 alpha Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry: HP1 alpha Antibody (8C3M6) [NBP3-16267] - Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using HP1 alpha Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, IP
• Clone: 8C3M6
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

HP1 alpha Antibody (8C3M6) Summary

• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 92-191 of human HP1 alpha (P45973). SNFSNSADDIKSKKKREQSNDIARGFERGLEPEKIIGATDSCGDLMFLMKWKDTDEADLVLAKEANVKCPQIVIAFYEERLTWHAYPEDAENKEKETAKS
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: CBX5
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:20-1:50
  • Immunoprecipitation 0.5 μg-4 μg antibody for 200μg-400μg extracts of whole cells
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for HP1 alpha Antibody (8C3M6)

• Antigen p25
• chromobox homolog 5 (Drosophila HP1 alpha)
• chromobox homolog 5 (HP1 alpha homolog, Drosophila)
• chromobox homolog 5
• chromobox protein homolog 5
• Heterochromatin protein 1 homolog alpha
• heterochromatin protein 1-alpha
• HP1 alpha homolog
• HP1 alpha
• HP1
• HP1A
• HP1-ALPHA
• HP1Hs alpha
• HP1Hs-alpha

Background

Heterochromatin protein-1 (HP1) is a methyl-lysine binding adapter protein that is involved in a variety important functions in the cell nucleus. Localized at heterochromatin sites, HP1 is responsible for gene repression by heterochromatin formation, transcriptional activation, regulation of binding of cohesion complexes to centromere, sequesteration of genes to nuclear periphery, transcriptional arrest, maintenance of heterochromatin integrity, gene repression at single nucleosome level and gene repression by heterochromatization of euchromatin.

HP1 antibodies are useful tools for research on transcription regulation and epigenetic signaling.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CBX5