HNRNPUL1 Antibody - BSA Free

Western Blot: HNRNPUL1 Antibody [NBP2-47432] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG.

Immunocytochemistry/Immunofluorescence: HNRNPUL1 Antibody [NBP2-47432] - Immunofluorescent staining of human cell line HEK 293 shows localization to nucleoplasm.

Immunohistochemistry-Paraffin: HNRNPUL1 Antibody [NBP2-47432] - Staining of human testis.

Immunohistochemistry-Paraffin: HNRNPUL1 Antibody [NBP2-47432] - Staining of human colon, kidney, liver and testis using Anti-HNRNPUL1 antibody NBP2-47432 (A) shows similar protein distribution across tissues to independent antibody NBP2-47431 (B).

Immunohistochemistry-Paraffin: HNRNPUL1 Antibody [NBP2-47432] - Staining of human liver.

Immunohistochemistry-Paraffin: HNRNPUL1 Antibody [NBP2-47432] - Staining of human kidney.

Immunohistochemistry-Paraffin: HNRNPUL1 Antibody [NBP2-47432] - Staining of human colon.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

HNRNPUL1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit HNRNPUL1 Antibody - BSA Free (NBP2-47432) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: NESGYERRPLEMEQQQAYRPEMKTEMKQGAPTSFLPPEASQLKPDRQQFQSRKRPYEENRGRGYFEHREDRRGRSPQPPAEEDE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HNRNPUL1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  HNRNPUL1 Protein (NBP2-47432PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (85%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for HNRNPUL1 Antibody - BSA Free

• Adenovirus early region 1B-associated protein 5
• E1B-AP5E1B 55kDa associated protein 5
• E1BAP5E1B-55 kDa-associated protein 5
• FLJ12944
• heterogeneous nuclear ribonucleoprotein U-like 1
• heterogeneous nuclear ribonucleoprotein U-like protein 1
• HNRPUL1E1B-55kDa-associated protein 5

Background

HNRNPUL1 encodes a nuclear RNA-binding protein of the heterogeneous nuclear ribonucleoprotein (hnRNP) family. This protein binds specifically to adenovirus E1B-55kDa oncoprotein. It may play an important role in nucleocytoplasmic RNA transport, and its function is modulated by E1B-55kDa in adenovirus-infected cells. Two transcript variants encoding different isoforms have been found for this gene. Additional variants have also been found, but their full-length natures have not been determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HNRNPUL1