HNRNPUL1 Antibody


Western Blot: HNRNPUL1 Antibody [NBP2-47432] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG.
Immunocytochemistry/ Immunofluorescence: HNRNPUL1 Antibody [NBP2-47432] - Immunofluorescent staining of human cell line HEK 293 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: HNRNPUL1 Antibody [NBP2-47432] - Staining of human testis.
Immunohistochemistry-Paraffin: HNRNPUL1 Antibody [NBP2-47432] - Staining of human stomach shows strong nuclear and cytoplasmic positivity in glandular cells.
Independent Antibodies: Immunohistochemistry-Paraffin: HNRNPUL1 Antibody [NBP2-47432] - Staining of human colon, kidney, liver and testis using Anti-HNRNPUL1 antibody NBP2-47432 (A) shows similar protein more
Immunohistochemistry-Paraffin: HNRNPUL1 Antibody [NBP2-47432] - Staining of human liver.
Immunohistochemistry-Paraffin: HNRNPUL1 Antibody [NBP2-47432] - Staining of human kidney.
Immunohistochemistry-Paraffin: HNRNPUL1 Antibody [NBP2-47432] - Staining of human colon.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Validated by:

Independent Antibodies


Order Details

HNRNPUL1 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: NESGYERRPLEMEQQQAYRPEMKTEMKQGAPTSFLPPEASQLKPDRQQFQSRKRPYEENRGRGYFEHREDRRGRSPQPPAEEDE
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
HNRNPUL1 Protein (NBP2-47432PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (85%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for HNRNPUL1 Antibody

  • Adenovirus early region 1B-associated protein 5
  • E1B-AP5E1B 55kDa associated protein 5
  • E1BAP5E1B-55 kDa-associated protein 5
  • FLJ12944
  • heterogeneous nuclear ribonucleoprotein U-like 1
  • heterogeneous nuclear ribonucleoprotein U-like protein 1
  • HNRPUL1E1B-55kDa-associated protein 5


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Bv, Ca, Pm, Xp, Dr(-), Mu(-)
Applications: WB, ELISA, Flow, ICC/IF, IP, MiAr, CyTOF-ready
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, IHC, ICC
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP, KD
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB
Species: Hu, Pm
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IP
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF

Publications for HNRNPUL1 Antibody (NBP2-47432) (0)

There are no publications for HNRNPUL1 Antibody (NBP2-47432).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HNRNPUL1 Antibody (NBP2-47432) (0)

There are no reviews for HNRNPUL1 Antibody (NBP2-47432). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HNRNPUL1 Antibody (NBP2-47432) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional HNRNPUL1 Products

Bioinformatics Tool for HNRNPUL1 Antibody (NBP2-47432)

Discover related pathways, diseases and genes to HNRNPUL1 Antibody (NBP2-47432). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HNRNPUL1 Antibody (NBP2-47432)

Discover more about diseases related to HNRNPUL1 Antibody (NBP2-47432).

Pathways for HNRNPUL1 Antibody (NBP2-47432)

View related products by pathway.

PTMs for HNRNPUL1 Antibody (NBP2-47432)

Learn more about PTMs related to HNRNPUL1 Antibody (NBP2-47432).

Blogs on HNRNPUL1

There are no specific blogs for HNRNPUL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our HNRNPUL1 Antibody and receive a gift card or discount.


Gene Symbol HNRNPUL1