hnRNP C1 + C2 Antibody (7A10N5)

Western Blot: hnRNP C1 + C2 Antibody (7A10N5) [NBP3-16725] - Western blot analysis of extracts of various cell lines, using hnRNP C1 + C2 Rabbit mAb (NBP3-16725) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3s.

Immunocytochemistry/Immunofluorescence: hnRNP C1 + C2 Antibody (7A10N5) [NBP3-16725] - Immunofluorescence analysis of U-2 OS cells using hnRNP C1 + C2 Rabbit mAb (NBP3-16725) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: hnRNP C1 + C2 Antibody (7A10N5) [NBP3-16725] - Confocal imaging of U-2 OS cells using hnRNP C1 + C2 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L).The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo(R) 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green).DAPI was used for nuclear staining (Blue). Objective: 100x.

Immunocytochemistry/ Immunofluorescence: hnRNP C1 + C2 Antibody (7A10N5) [NBP3-16725] - Confocal imaging of paraffin-embedded Human colon cancer using hnRNP C1 + C2 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.

• Reactivity: Hu, Mu
• Applications: WB, ICC/IF
• Clone: 7A10N5
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

hnRNP C1 + C2 Antibody (7A10N5) Summary

• Description: Novus Biologicals Rabbit hnRNP C1 + C2 Antibody (7A10N5) (NBP3-16725) is a recombinant monoclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 80-170 of human hnRNP C1 + C2 (P07910). LDINLAAEPKVNRGKAGVKRSAAEMYGSVTEHPSPSPLLSSSFDLDYDFQRDYYDRMYSYPARVPPPPPIARAVVPSKRQRVSGNTSRRGK
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: HNRNPC
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for hnRNP C1 + C2 Antibody (7A10N5)

• C1
• C2
• heterogeneous nuclear ribonucleoprotein C (C1/C2)
• heterogeneous nuclear ribonucleoproteins C1/C2
• hnRNP C1/C2
• HNRNP
• hnRNPC
• HNRPC
• MGC104306
• MGC105117
• MGC117353
• MGC131677
• nuclear ribonucleoprotein particle C1 protein
• nuclear ribonucleoprotein particle C2 protein
• SNRPC

Background

RNA polymerase II transcripts in the nucleus are in complex with several proteins called heterogeneous nuclear ribonucleoproteins (hnRNPs). These proteins are important in biological activities such as transcription, pre-mRNA processing, cytoplasmic mRNA translation, and turnover. hnRNPs can be isolated either by immunoprecipitation or by sucrose gradient fractionation of cell extracts. When this is performed, the hnRNPs are isolated (consisting of protein groups named A to U), and many of these protein groups consist of more than one isoform. The major steadystate proteins of the isolated hnRNP complex are the A1, A2, B1, B2, C1, and C2 with a range of molecular weight starting with 34 kDa up to 43 kDa. The hnRNP-C proteins have a single RNP motif RNA-binding domain (RBD) of 80 to 100 amino acid long. The hnRNP -C proteins preferentially bind to uridine-rich RNA sequences. Oligomerization of the protein through leucine rich regions in its C-terminal end is important for RNA binding.4 Although its physiological action is unknown, mutation of the hnRNPC gene causes a embryonic lethal phenotype.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HNRNPC