hnRNP A1 Antibody

Images

 
Western Blot: hnRNP A1 Antibody [NBP2-14096] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: hnRNP A1 Antibody [NBP2-14096] - Staining of human fallopian tube shows strong nuclear positivity.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

hnRNP A1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ETTDESLRSHFERWGMLTDCAVMRDPNTKRSRGFGFVTYATVEEVDAATN ARPHKVDGKVVEPRRTVSREDYQRSGAHLTVKKIFVGGIKENTEKHQLRD YFEQHGKMEVIEIMTEAVARKGALPL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HNRNPA1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
hnRNP A1 Protein (NBP2-14096PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (80%), Rat (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for hnRNP A1 Antibody

  • Helix-destabilizing protein
  • heterogeneous nuclear ribonucleoprotein A1
  • heterogeneous nuclear ribonucleoprotein A1B protein
  • heterogeneous nuclear ribonucleoprotein B2 protein
  • heterogeneous nuclear ribonucleoprotein core protein A1
  • hnRNP A1
  • hnRNP core protein A1
  • hnRNPA1
  • hnRNP-A1
  • HNRPA1MGC102835
  • nuclear ribonucleoprotein particle A1 protein
  • single-strand DNA-binding protein UP1
  • Single-strand RNA-binding protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20324
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NB100-230
Species: Hu
Applications: WB, IP, PLA
NB100-233
Species: Hu
Applications: WB, PLA
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NBL1-11228
Species: Hu
NBP1-59069
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86191
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38806
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5540
Species: Mu
Applications: WB
H00006607-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
H00728695-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-1774
Species: Hu, Rt, Am, Dr
Applications: WB, EM, ELISA, ICC/IF, IP
MAB4218
Species: Hu
Applications: WB, IHC
NB100-1936
Species: Hu, Mu, Rt, Pm, Xp
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-91865
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for hnRNP A1 Antibody (NBP2-14096) (0)

There are no publications for hnRNP A1 Antibody (NBP2-14096).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for hnRNP A1 Antibody (NBP2-14096) (0)

There are no reviews for hnRNP A1 Antibody (NBP2-14096). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for hnRNP A1 Antibody (NBP2-14096) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional hnRNP A1 Products

Bioinformatics Tool for hnRNP A1 Antibody (NBP2-14096)

Discover related pathways, diseases and genes to hnRNP A1 Antibody (NBP2-14096). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for hnRNP A1 Antibody (NBP2-14096)

Discover more about diseases related to hnRNP A1 Antibody (NBP2-14096).
 

Pathways for hnRNP A1 Antibody (NBP2-14096)

View related products by pathway.

PTMs for hnRNP A1 Antibody (NBP2-14096)

Learn more about PTMs related to hnRNP A1 Antibody (NBP2-14096).
 

Research Areas for hnRNP A1 Antibody (NBP2-14096)

Find related products by research area.

Blogs on hnRNP A1.

hnRNP A1 - a ribonucleoprotein regulating gene expression at many levels
Heterogeneous nuclear ribonucleoprotein A1 (hnRNP A1) is an abundant ubiquitously expressed protein with important roles in the regulation of gene expression. hnRNP A1 is involved in transcription as well as the splicing, trafficking, and translati...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our hnRNP A1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HNRNPA1